Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1198
Gene name Gene Name - the full gene name approved by the HGNC.	CDC like kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLK3
Synonyms (NCBI Gene) Gene synonyms aliases	PHCLK3, PHCLK3/152
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two trans

Show/Hide all(22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025715	hsa-miR-7-5p	Sequencing	20371350
MIRT737435	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC)	31807004
MIRT896705	hsa-miR-3121-3p	CLIP-seq
MIRT896706	hsa-miR-4453	CLIP-seq
MIRT896707	hsa-miR-4538	CLIP-seq
MIRT896708	hsa-miR-4795-3p	CLIP-seq
MIRT896709	hsa-miR-4803	CLIP-seq
MIRT1965861	hsa-miR-1208	CLIP-seq
MIRT1965862	hsa-miR-205	CLIP-seq
MIRT1965863	hsa-miR-23a	CLIP-seq
MIRT1965864	hsa-miR-23b	CLIP-seq
MIRT1965865	hsa-miR-23c	CLIP-seq
MIRT1965866	hsa-miR-25	CLIP-seq
MIRT1965867	hsa-miR-32	CLIP-seq
MIRT1965868	hsa-miR-363	CLIP-seq
MIRT1965869	hsa-miR-3667-3p	CLIP-seq
MIRT1965870	hsa-miR-367	CLIP-seq
MIRT1965871	hsa-miR-4297	CLIP-seq
MIRT1965872	hsa-miR-4325	CLIP-seq
MIRT1965873	hsa-miR-4722-3p	CLIP-seq
MIRT1965874	hsa-miR-92a	CLIP-seq
MIRT1965875	hsa-miR-92b	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
AR	Repression	16281084

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	7990150
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 21516116, 22939624, 23455924, 23602568, 25416956, 31515488, 32296183, 32707033, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9637771
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006468	Process	Protein phosphorylation	IDA	9637771
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043484	Process	Regulation of RNA splicing	IBA
GO:0043484	Process	Regulation of RNA splicing	IDA	9637771
GO:0043484	Process	Regulation of RNA splicing	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602990	2071	ENSG00000179335

Protein

UniProt ID

P49761

Protein name

Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3)

Protein function

Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex. May be a constituent of a network of regulatory mechanisms that enabl

PDB

2EU9 , 2EXE , 2WU6 , 2WU7 , 3RAW , 6FT7 , 6FYP , 6FYR , 6KHF , 6RCT , 6YTW , 6YTY , 6YU1 , 6Z2V , 6Z51 , 6Z52 , 6Z53 , 6Z54 , 6Z55 , 9EZ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	304 → 620	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Endothelial cells. {ECO:0000269|PubMed:19168442}.

Sequence

MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGG
GPGQARPLGPPGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGL
PRAEVAAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
RLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHR
RRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
LEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR

Sequence length

638

Interactions

View interactions

CLK3 (CDC like kinase 3)