Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	119391
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione S-transferase omega 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSTO2
Synonyms (NCBI Gene) Gene synonyms aliases	GSTO 2-2, bA127L20.1
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq,

Show/Hide all(70)

miRTarBase ID	miRNA	Experiments	Reference
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 31515488, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	15970797
GO:0016491	Function	Oxidoreductase activity	IDA	15970797
GO:0019852	Process	L-ascorbic acid metabolic process	IDA	15970797
GO:0019852	Process	L-ascorbic acid metabolic process	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IBA	21873635
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IDA	15970797
GO:0050610	Function	Methylarsonate reductase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071243	Process	Cellular response to arsenic-containing substance	IDA	15970797
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

MIM	HGNC	e!Ensembl
612314	23064	ENSG00000065621

Protein

UniProt ID

Q9H4Y5

Protein name

Glutathione S-transferase omega-2 (GSTO-2) (EC 2.5.1.18) (Glutathione S-transferase omega 2-2) (GSTO 2-2) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2)

Protein function

Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsoni

PDB

3Q18 , 3Q19 , 3QAG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13417	GST_N_3	26 → 101	Glutathione S-transferase, N-terminal domain	Domain
PF13410	GST_C_2	108 → 206		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis. {ECO:0000269|PubMed:12618591}.

Sequence

MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC

Sequence length

243

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation Vitamin C (ascorbate) metabolism

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA
Uterine Fibroids	Uterine Fibroids		GWAS

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	15040808, 15985314
Amyotrophic lateral sclerosis 1	Associate	34311603
Asthma	Associate	24471578
Carcinoma Hepatocellular	Associate	25835968, 25892883, 27221910
Carcinoma Renal Cell	Associate	30224590
Cataract	Associate	22876127
Death	Associate	24040330, 25835968
Diabetes Mellitus	Associate	36676788
Diabetic Nephropathies	Associate	36676788
Drug Hypersensitivity	Associate	24471578
Fibrosis	Associate	25892883, 27221910
Graft vs Host Disease	Associate	26103006
Helicobacter Infections	Inhibit	34925643
Hepatitis B	Associate	27221910
Hypertension	Associate	30224590
Lung Neoplasms	Associate	22044695
Lymphatic Metastasis	Associate	25835968
Neoplasms	Associate	21798077, 25835968, 30224590
Neurodegenerative Diseases	Associate	30224590
Non Muscle Invasive Bladder Neoplasms	Associate	24040330
Obesity	Associate	30224590
Parkinson Disease	Associate	15040808, 15985314
Parkinson Disease	Inhibit	17194543
Pulmonary Disease Chronic Obstructive	Associate	17903307, 22044695
Renal Insufficiency Chronic	Associate	31924810
Skin Diseases	Associate	17505575
Status Asthmaticus	Associate	20367187, 24471578
Stomach Neoplasms	Inhibit	34925643
Urethral Neoplasms	Associate	21798077
Urinary Bladder Neoplasms	Associate	22306368, 24040330

GSTO2 (glutathione S-transferase omega 2)