Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	118611
Gene name Gene Name - the full gene name approved by the HGNC.	Chromosome 10 open reading frame 90
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C10orf90
Synonyms (NCBI Gene) Gene synonyms aliases	FATS, bA422P15.2
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.2

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments
MIRT829322	hsa-miR-1280	CLIP-seq
MIRT829323	hsa-miR-1825	CLIP-seq
MIRT829324	hsa-miR-199a-5p	CLIP-seq
MIRT829325	hsa-miR-199b-5p	CLIP-seq
MIRT829326	hsa-miR-2355-5p	CLIP-seq
MIRT829327	hsa-miR-3679-3p	CLIP-seq
MIRT829328	hsa-miR-3689d	CLIP-seq
MIRT829329	hsa-miR-3691-3p	CLIP-seq
MIRT829330	hsa-miR-3713	CLIP-seq
MIRT829331	hsa-miR-4286	CLIP-seq
MIRT829332	hsa-miR-4666-5p	CLIP-seq
MIRT829333	hsa-miR-4802-3p	CLIP-seq
MIRT829334	hsa-miR-4802-5p	CLIP-seq
MIRT829335	hsa-miR-876-3p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	20844083
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	20844083
GO:0005814	Component	Centriole	IBA	21873635
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0015629	Component	Actin cytoskeleton	IDA	20844083
GO:0016567	Process	Protein ubiquitination	ISS
GO:0046599	Process	Regulation of centriole replication	IBA	21873635
GO:0050821	Process	Protein stabilization	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	ISS

MIM	HGNC	e!Ensembl
617735	26563	ENSG00000154493

Protein

UniProt ID

Q96M02

Protein name

(E2-independent) E3 ubiquitin-conjugating enzyme FATS (EC 2.3.2.-) (Centrosomal protein C10orf90) (E2/E3 hybrid ubiquitin-protein ligase FATS) (Fragile-site associated tumor suppressor homolog) (FATS)

Protein function

Tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. Acts as a p53/TP53 activator by inhibiting MDM2 binding to p53/TP53 and stimulating non-proteolytic polyubiquitination of p53/TP53. Exhibits ubiquitin ligase (E3) act

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17730	Centro_C10orf90	52 → 563	Centrosomal C10orf90	Family
PF15309	ALMS_motif	567 → 697	ALMS motif	Family

Sequence

MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDE
NKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEA
ELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPAL
ANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPL
SGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHR
LTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGAC
PWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF
SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPR
ILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
APSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQ
RKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLP
EVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV

Sequence length

699

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Prostate cancer	Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27515689
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21926974

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Alzheimer disease	Alzheimer disease		GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Alcohol Related Disorders	Associate	26223354
Breast Neoplasms	Associate	26223354, 28402275
Carcinogenesis	Associate	26223354, 28402275
Carcinoma Non Small Cell Lung	Inhibit	33037185
Colorectal Neoplasms	Inhibit	39408824
Melanoma	Associate	30672666
Neoplasm Metastasis	Associate	30672666
Neoplasms	Associate	28402275
Neoplasms	Inhibit	30672666, 33037185, 34769520, 39408824
Pinguecula	Inhibit	34769520
Pterygium	Inhibit	34769520
Pulmonary Disease Chronic Obstructive	Associate	39408824

C10orf90 (chromosome 10 open reading frame 90)