C10orf90 (chromosome 10 open reading frame 90)

Gene

• Entrez ID: 118611
• Gene name: Chromosome 10 open reading frame 90
• Gene symbol: C10orf90
• Synonyms (NCBI Gene): FATS, bA422P15.2
• Chromosome: 10
• Chromosome location: 10q26.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT829322	hsa-miR-1280	CLIP-seq
MIRT829323	hsa-miR-1825	CLIP-seq
MIRT829324	hsa-miR-199a-5p	CLIP-seq
MIRT829325	hsa-miR-199b-5p	CLIP-seq
MIRT829326	hsa-miR-2355-5p	CLIP-seq
MIRT829327	hsa-miR-3679-3p	CLIP-seq
MIRT829328	hsa-miR-3689d	CLIP-seq
MIRT829329	hsa-miR-3691-3p	CLIP-seq
MIRT829330	hsa-miR-3713	CLIP-seq
MIRT829331	hsa-miR-4286	CLIP-seq
MIRT829332	hsa-miR-4666-5p	CLIP-seq
MIRT829333	hsa-miR-4802-3p	CLIP-seq
MIRT829334	hsa-miR-4802-5p	CLIP-seq
MIRT829335	hsa-miR-876-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	20844083
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	20844083
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	20844083
GO:0016567	Process	Protein ubiquitination	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0046599	Process	Regulation of centriole replication	IBA
GO:0050821	Process	Protein stabilization	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	ISS

Other IDs

• MIM: 617735
• HGNC: 26563
• e!Ensembl: ENSG00000154493

Protein

• UniProt ID: Q96M02
• Protein name: (E2-independent) E3 ubiquitin-conjugating enzyme FATS (EC 2.3.2.-) (Centrosomal protein C10orf90) (E2/E3 hybrid ubiquitin-protein ligase FATS) (Fragile-site associated tumor suppressor homolog) (FATS)
• Protein function: Tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. Acts as a p53/TP53 activator by inhibiting MDM2 binding to p53/TP53 and stimulating non-proteolytic polyubiquitination of p53/TP53. Exhibits ubiquitin ligase (E3) act
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17730	Centro_C10orf90	52 → 563	Centrosomal C10orf90	Family
  PF15309	ALMS_motif	567 → 697	ALMS motif	Family

• Sequence:

  MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDE
  NKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEA
  ELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPAL
  ANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPL
  SGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHR
  LTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGAC
  PWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF
  SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPR
  ILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
  APSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQ
  RKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLP
  EVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV

• Sequence length: 699

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Colon adenocarcinoma	Benign	rs74814928	RCV005908782
Nonpapillary renal cell carcinoma	Benign	rs74814928	RCV005908783

Associations from Text Mining
Disease Name	Relationship Type	References
Alcohol Related Disorders	Associate	26223354
Breast Neoplasms	Associate	26223354, 28402275
Carcinogenesis	Associate	26223354, 28402275
Carcinoma Non Small Cell Lung	Inhibit	33037185
Colorectal Neoplasms	Inhibit	39408824
Melanoma	Associate	30672666
Neoplasm Metastasis	Associate	30672666
Neoplasms	Associate	28402275
Neoplasms	Inhibit	30672666, 33037185, 34769520, 39408824
Pinguecula	Inhibit	34769520
Pterygium	Inhibit	34769520
Pulmonary Disease Chronic Obstructive	Associate	39408824