DCD (dermcidin)

Gene

• Entrez ID: 117159
• Gene name: Dermcidin
• Gene symbol: DCD
• Synonyms (NCBI Gene): AIDD, DCD-1, DSEP, HCAP, PIF
• Chromosome: 12
• Chromosome location: 12q13.2
• Summary: This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-te

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT032404	hsa-let-7b-5p	Proteomics	18668040
MIRT925859	hsa-miR-513a-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005216	Function	Monoatomic ion channel activity	IBA
GO:0005216	Function	Monoatomic ion channel activity	IDA	22262861
GO:0005253	Function	Monoatomic anion channel activity	IDA	23426625
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IDA	9736629
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11694882, 14978112
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008289	Function	Lipid binding	EXP	22262861, 28888369
GO:0015698	Process	Inorganic anion transport	IDA	23426625
GO:0016020	Component	Membrane	IDA	23426625
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019898	Component	Extrinsic component of membrane	IDA	23426625
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0031640	Process	Killing of cells of another organism	IMP	11694882
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IDA	22262861
GO:0042742	Process	Defense response to bacterium	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	11694882
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	11694882
GO:0050832	Process	Defense response to fungus	IEA
GO:0050832	Process	Defense response to fungus	IMP	11694882
GO:0051873	Process	Killing by host of symbiont cells	IDA	15670776
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	11694882
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA

Other IDs

• MIM: 606634
• HGNC: 14669
• e!Ensembl: ENSG00000161634

Protein

• UniProt ID: P81605
• Protein name: Dermcidin (EC 3.4.-.-) (Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1]
• Protein function: [DCD-1]: Found in sweat, has an antimicrobial activity during early bacterial colonization (PubMed:11694882, PubMed:23426625). The secreted peptide assembles into homohexameric complexes that can associate with and also insert into pathogen memb
• PDB: 2KSG, 2NDK, 2YMK, 6SHK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15291	Dermcidin	19 → 106	Dermcidin, antibiotic peptide	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Constitutively expressed in eccrine sweat gland cells (at protein level). Secreted into the sweat at a concentration of 1-10 micrograms/ml. {ECO:
• Sequence:

  MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
  QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

• Sequence length: 110

Pathways

Reactome:

Antimicrobial peptides