Gene Gene information from NCBI Gene database.
Entrez ID 117145
Gene name Thioesterase superfamily member 4
Gene symbol THEM4
Synonyms (NCBI Gene)
CTMP
Chromosome 1
Chromosome location 1q21.3
Summary Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory doma
miRNA miRNA information provided by mirtarbase database.
734
miRTarBase ID miRNA Experiments Reference
MIRT005171 hsa-miR-30a-5p pSILAC 18668040
MIRT005171 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT031745 hsa-miR-16-5p Proteomics 18668040
MIRT693161 hsa-miR-3609 HITS-CLIP 23313552
MIRT693162 hsa-miR-548ah-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19541650, 22309289, 24670654, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 19604401
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606388 17947 ENSG00000159445
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T1C6
Protein name Acyl-coenzyme A thioesterase THEM4 (Acyl-CoA thioesterase THEM4) (EC 3.1.2.2) (Carboxyl-terminal modulator protein) (Thioesterase superfamily member 4)
Protein function Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays a role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1
PDB 4AE8 , 4GAH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03061 4HBT 148 223 Thioesterase superfamily Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation. {ECO:0000269|PubMed:11598301, ECO:0000269|PubMed:
Sequence
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLG
FEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANL
NINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLY
SEATSLFIKLNPAKSLT
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Fatty acid elongation
Metabolic pathways
PI3K-Akt signaling pathway
  PIP3 activates AKT signaling
Activation of AKT2
Negative regulation of the PI3K/AKT network
CD28 dependent PI3K/Akt signaling
VEGFR2 mediated vascular permeability
Mitochondrial Fatty Acid Beta-Oxidation