Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116844
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich alpha-2-glycoprotein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRG1
Synonyms (NCBI Gene) Gene synonyms aliases
HMFT1766, LRG
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O`Donnell et al.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006448 hsa-miR-335-5p Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22382496
MIRT006448 hsa-miR-335-5p Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22382496
MIRT006448 hsa-miR-335-5p Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22382496
MIRT679358 hsa-miR-122-3p HITS-CLIP 23824327
MIRT679357 hsa-miR-4740-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001938 Process Positive regulation of endothelial cell proliferation IEA
GO:0001938 Process Positive regulation of endothelial cell proliferation IMP 23868260
GO:0005114 Function Type II transforming growth factor beta receptor binding IPI 23868260
GO:0005160 Function Transforming growth factor beta receptor binding IEA
GO:0005515 Function Protein binding IPI 23868260, 28514442, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611289 29480 ENSG00000171236
Protein
UniProt ID P02750
Protein name Leucine-rich alpha-2-glycoprotein (LRG)
PDB 7Q4Q , 8H24
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 71 128 Leucine rich repeat Repeat
PF13855 LRR_8 116 176 Leucine rich repeat Repeat
PF13855 LRR_8 168 224 Leucine rich repeat Repeat
PF13855 LRR_8 212 272 Leucine rich repeat Repeat
PF13855 LRR_8 236 285 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Plasma.
Sequence
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
EIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
LDLTRNAL
TGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSL
ASVPEGLWASLGQ
PNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Sequence length 347
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Leucine-rich alpha-2-glycoprotein 1 levels in type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 33672727
Acute Coronary Syndrome Associate 34002800
Adenocarcinoma of Lung Associate 32064933
Adenoma Associate 31784980
adult multisystem inflammatory disease COVID 19 related Associate 35699824
Anemia Refractory with Excess of Blasts Stimulate 24958999
Bernard Soulier Syndrome Associate 7690959
Breast Neoplasms Associate 27491861, 33386492
Carcinogenesis Associate 37786278
Carcinoma Hepatocellular Associate 26517349