Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	116844
Gene name Gene Name - the full gene name approved by the HGNC.	Leucine rich alpha-2-glycoprotein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LRG1
Synonyms (NCBI Gene) Gene synonyms aliases	HMFT1766, LRG
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O`Donnell et al.

Show/Hide all(100)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT679358	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679357	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679356	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679355	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679354	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679352	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679353	hsa-miR-1976	HITS-CLIP	23824327
MIRT679351	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679350	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT679349	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT679348	hsa-miR-4279	HITS-CLIP	23824327
MIRT489906	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT489905	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT489904	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT679358	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679357	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679356	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679355	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679354	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679352	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679353	hsa-miR-1976	HITS-CLIP	23824327
MIRT679351	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679350	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT679349	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT679348	hsa-miR-4279	HITS-CLIP	23824327
MIRT489906	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT489905	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT489904	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT1117558	hsa-miR-1207-3p	CLIP-seq
MIRT1117559	hsa-miR-1224-3p	CLIP-seq
MIRT1117560	hsa-miR-1252	CLIP-seq
MIRT1117561	hsa-miR-197	CLIP-seq
MIRT1117562	hsa-miR-3194-3p	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT1117564	hsa-miR-3202	CLIP-seq
MIRT1117565	hsa-miR-431	CLIP-seq
MIRT1117566	hsa-miR-4426	CLIP-seq
MIRT1117567	hsa-miR-4454	CLIP-seq
MIRT1117568	hsa-miR-4476	CLIP-seq
MIRT1117569	hsa-miR-4533	CLIP-seq
MIRT1117570	hsa-miR-4647	CLIP-seq
MIRT1117571	hsa-miR-4662a-5p	CLIP-seq
MIRT1117572	hsa-miR-4662b	CLIP-seq
MIRT1117573	hsa-miR-4716-5p	CLIP-seq
MIRT1117574	hsa-miR-5096	CLIP-seq
MIRT1117575	hsa-miR-552	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033230	hsa-miR-1228	CLIP-seq
MIRT2033231	hsa-miR-1281	CLIP-seq
MIRT2033232	hsa-miR-1305	CLIP-seq
MIRT2033233	hsa-miR-145	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT2033235	hsa-miR-3189-3p	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT2033236	hsa-miR-3616-3p	CLIP-seq
MIRT2033237	hsa-miR-4328	CLIP-seq
MIRT2033238	hsa-miR-4477a	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT2033242	hsa-miR-498	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT2033244	hsa-miR-635	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT1117562	hsa-miR-3194-3p	CLIP-seq
MIRT2263530	hsa-miR-3672	CLIP-seq
MIRT1117565	hsa-miR-431	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117575	hsa-miR-552	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033231	hsa-miR-1281	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT2562850	hsa-miR-24	CLIP-seq
MIRT2562851	hsa-miR-411	CLIP-seq
MIRT2562852	hsa-miR-4284	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT2562850	hsa-miR-24	CLIP-seq
MIRT2562852	hsa-miR-4284	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0003674	Function	Molecular_function	ND
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	23868260
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	NAS	12223515, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	20363744
GO:0008150	Process	Biological_process	ND
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	NAS	3856868
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
611289	29480	ENSG00000171236

Protein

UniProt ID

P02750

Protein name

Leucine-rich alpha-2-glycoprotein (LRG)

PDB

7Q4Q , 8H24

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	71 → 128	Leucine rich repeat	Repeat
PF13855	LRR_8	116 → 176	Leucine rich repeat	Repeat
PF13855	LRR_8	168 → 224	Leucine rich repeat	Repeat
PF13855	LRR_8	212 → 272	Leucine rich repeat	Repeat
PF13855	LRR_8	236 → 285	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Plasma.

Sequence

MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
EIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
LDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Sequence length

347

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	25200834
Multiple polyposis syndrome	Adenomatous Polyposis Coli, Polyposis, Adenomatous Intestinal, Familial Intestinal Polyposis	rs137854568, rs137854569, rs387906231, rs137854574, rs137854575, rs387906234, rs587776520, rs387906236, rs137854580, rs387906239, rs397515732, rs397515733, rs397515734, rs397515735, rs587779352 View all (85 more)	25200834

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (74)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Stimulate	33672727
Acute Coronary Syndrome	Associate	34002800
Adenocarcinoma of Lung	Associate	32064933
Adenoma	Associate	31784980
adult multisystem inflammatory disease COVID 19 related	Associate	35699824
Anemia Refractory with Excess of Blasts	Stimulate	24958999
Bernard Soulier Syndrome	Associate	7690959
Breast Neoplasms	Associate	27491861, 33386492
Carcinogenesis	Associate	37786278
Carcinoma Hepatocellular	Associate	26517349
Carcinoma Non Small Cell Lung	Associate	23284758
Carcinoma Ovarian Epithelial	Associate	19709441
Carcinoma Pancreatic Ductal	Associate	30137376, 30575211
Carcinoma Renal Cell	Associate	31753726, 32337221, 37213667
Choroidal Neovascularization	Associate	34445590
Colitis Ulcerative	Associate	33623482
Colorectal Neoplasms	Associate	28376129, 31753726, 32023884, 37786278
Coronary Artery Disease	Associate	27118092, 33506919
Crohn Disease	Associate	33623482, 38069288
Diabetic Foot	Stimulate	35068329
Drug Hypersensitivity	Inhibit	27378305
Dwarfism stiff joint ocular abnormalities	Stimulate	36569927
Endometrial Neoplasms	Associate	24760273
Epidermodysplasia Verruciformis	Associate	36500247
Esophageal Squamous Cell Carcinoma	Associate	25973038
Familial Primary Pulmonary Hypertension	Associate	19703762
Fibrosis	Associate	36569927
Fibrous Dysplasia Polyostotic	Associate	35699824
Glioblastoma	Associate	29513714
Heart Failure Diastolic	Associate	36291628
Immunoglobulin G4 Related Disease	Associate	34453919
Inflammation	Stimulate	28746773
Inflammation	Associate	28819457, 30575211, 32252660, 33623482, 35699824, 36569927, 37229810
Inflammatory Bowel Diseases	Associate	33623482
Kidney Diseases	Associate	32252660
Leukemia	Associate	30455412
Leukemia Myeloid Acute	Associate	30455412
Lung Neoplasms	Associate	23284758
Lupus Nephritis	Stimulate	32252660
Lymphatic Metastasis	Associate	24760273
Macular Degeneration	Stimulate	34445590
Melanoma	Associate	37089863
Mouth Neoplasms	Stimulate	30987719
Mucocutaneous Lymph Node Syndrome	Associate	28262744, 35699824
Myelodysplastic Syndromes	Associate	35275518
Myocardial Infarction	Associate	33506919
Neoplasm Metastasis	Associate	30575211, 31753726, 34516824
Neoplasm Metastasis	Stimulate	34516824
Neoplasms	Associate	23284758, 24760273, 25973038, 26517349, 28081565, 28376129, 28746773, 29513714, 30455412, 31753726, 32023884, 32337221
Neoplasms	Stimulate	34516824
Neuroblastoma	Associate	22382496
Neutrophilia Hereditary	Associate	35699824
Osteoarthritis	Stimulate	36569927
Osteoarthritis Knee	Associate	36569927
Ovarian Neoplasms	Stimulate	23579955
Pain	Associate	34608709
Pancreatic Neoplasms	Associate	17303479, 30575211
Pancreatitis Chronic	Stimulate	17303479
Prostatic Neoplasms	Stimulate	36500247
Prostatic Neoplasms	Associate	36681849
Prostatic Neoplasms Castration Resistant	Stimulate	36681849
Protein Losing Enteropathies	Associate	35318338
Pulmonary Disease Chronic Obstructive	Associate	31920121, 36411774
Pulmonary Fibrosis	Associate	36277429
Respiratory Tract Diseases	Associate	32780727
Rhinitis Allergic	Inhibit	27378305
Scleroderma Systemic	Stimulate	36277429
Spondylitis Ankylosing	Associate	31953524
Squamous Cell Carcinoma of Head and Neck	Stimulate	26552850
Still's Disease Adult Onset	Associate	33013889
Stomach Neoplasms	Associate	28746773
Tuberculosis Pulmonary	Associate	38512356
Urinary Bladder Neoplasms	Associate	34706720
Urinary Incontinence Stress	Associate	27193112

LRG1 (leucine rich alpha-2-glycoprotein 1)