Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116461
Gene name Gene Name - the full gene name approved by the HGNC.
TRNA splicing endonuclease subunit 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSEN15
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf19, PCH2F, sen15
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by Ref
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs730882223 T>G Likely-pathogenic, pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs879253779 A>G Pathogenic Missense variant, coding sequence variant, intron variant, non coding transcript variant
rs879253780 C>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052033 hsa-let-7b-5p CLASH 23622248
MIRT044997 hsa-miR-186-5p CLASH 23622248
MIRT1458384 hsa-miR-1208 CLIP-seq
MIRT1458385 hsa-miR-1243 CLIP-seq
MIRT1458386 hsa-miR-150 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
GO:0005730 Component Nucleolus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608756 16791 ENSG00000198860
Protein
UniProt ID Q8WW01
Protein name tRNA-splicing endonuclease subunit Sen15 (SEN15 homolog) (HsSEN15) (tRNA-intron endonuclease Sen15)
Protein function Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an
PDB 2GW6 , 6Z9U , 7UXA , 7ZRZ , 8HMY , 8HMZ , 8ISS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09631 Sen15 65 166 Sen15 protein Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in testis and uterus. {ECO:0000269|PubMed:11318611}.
Sequence
MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQV
YVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIR
EILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQN
ISLRR
Sequence length 171
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA processing in the nucleus
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Pontoneocerebellar hypoplasia pontocerebellar hypoplasia, type 2f rs879253779, rs879253780 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Osteoarthritis Of Hip Osteoarthritis (hip) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrial Fibrillation Associate 24944287
Developmental Disabilities Associate 27392077
Epilepsy Associate 27392077
Growth Disorders Associate 28744006
Intellectual Disability Associate 27392077
Microcephaly Associate 27392077
Osteoarthritis Associate 37208701
Pontocerebellar Hypoplasia Associate 27392077
Pontocerebellar Hypoplasia Type 2A Associate 27392077