Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116154
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatase and actin regulator 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PHACTR3
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf101, H17739, PPP1R123, SCAPIN1, SCAPININ
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.32-q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052804 hsa-miR-3181 CLASH 23622248
MIRT1228974 hsa-miR-200b CLIP-seq
MIRT1228975 hsa-miR-200c CLIP-seq
MIRT1228976 hsa-miR-3117-5p CLIP-seq
MIRT1228977 hsa-miR-425 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IEA
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608725 15833 ENSG00000087495
Protein
UniProt ID Q96KR7
Protein name Phosphatase and actin regulator 3 (Scaffold-associated PP1-inhibiting protein) (Scapinin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02755 RPEL 440 463 RPEL repeat Disordered
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in brain. Also found in several tumors such as lung carcinomas, nervous tumors and HL-60 leukemia cells. Isoform 3 is the major form in U-937, GOTO and HL-60 leukemia cells.
Sequence
MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTP
PVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQD
AESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDA
AKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSVGQLPSPPLLPTPPPK
ASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRA
LATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESE
ENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLT
RKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYK
SNEMEVHASSKHLTRFHRP
Sequence length 559
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Inflammatory Bowel Diseases Associate 37473877
Neoplasms Radiation Induced Associate 26681684
Radiation Fibrosis Syndrome Associate 26681684
Urinary Bladder Neoplasms Stimulate 35123558