Gene Gene information from NCBI Gene database.
Entrez ID 116154
Gene name Phosphatase and actin regulator 3
Gene symbol PHACTR3
Synonyms (NCBI Gene)
C20orf101H17739PPP1R123SCAPIN1SCAPININ
Chromosome 20
Chromosome location 20q13.32-q13.33
Summary This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it
miRNA miRNA information provided by mirtarbase database.
51
miRTarBase ID miRNA Experiments Reference
MIRT052804 hsa-miR-3181 CLASH 23622248
MIRT1228974 hsa-miR-200b CLIP-seq
MIRT1228975 hsa-miR-200c CLIP-seq
MIRT1228976 hsa-miR-3117-5p CLIP-seq
MIRT1228977 hsa-miR-425 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IEA
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608725 15833 ENSG00000087495
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KR7
Protein name Phosphatase and actin regulator 3 (Scaffold-associated PP1-inhibiting protein) (Scapinin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02755 RPEL 440 463 RPEL repeat Disordered
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in brain. Also found in several tumors such as lung carcinomas, nervous tumors and HL-60 leukemia cells. Isoform 3 is the major form in U-937, GOTO and HL-60 leukemia cells.
Sequence
MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTP
PVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQD
AESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDA
AKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSVGQLPSPPLLPTPPPK
ASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRA
LATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESE
ENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLT
RKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYK
SNEMEVHASSKHLTRFHRP
Sequence length 559
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Thyroid cancer, nonmedullary, 1 Uncertain significance rs138964292 RCV005932240
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Inflammatory Bowel Diseases Associate 37473877
Neoplasms Radiation Induced Associate 26681684
Radiation Fibrosis Syndrome Associate 26681684
Urinary Bladder Neoplasms Stimulate 35123558