Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	115352
Gene name Gene Name - the full gene name approved by the HGNC.	Fc receptor like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FCRL3
Synonyms (NCBI Gene) Gene synonyms aliases	CD307c, FCRH3, IFGP3, IRTA3, MAIA, SPAP2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments
MIRT994140	hsa-miR-1270	CLIP-seq
MIRT994141	hsa-miR-1273g	CLIP-seq
MIRT994142	hsa-miR-185	CLIP-seq
MIRT994143	hsa-miR-3925-5p	CLIP-seq
MIRT994144	hsa-miR-4306	CLIP-seq
MIRT994145	hsa-miR-4531	CLIP-seq
MIRT994146	hsa-miR-4644	CLIP-seq
MIRT994147	hsa-miR-4773	CLIP-seq
MIRT994148	hsa-miR-522	CLIP-seq
MIRT994149	hsa-miR-620	CLIP-seq
MIRT1994800	hsa-miR-1178	CLIP-seq
MIRT1994801	hsa-miR-1343	CLIP-seq
MIRT1994802	hsa-miR-2110	CLIP-seq
MIRT1994803	hsa-miR-3166	CLIP-seq
MIRT1994804	hsa-miR-4269	CLIP-seq
MIRT1994805	hsa-miR-4271	CLIP-seq
MIRT1994806	hsa-miR-4514	CLIP-seq
MIRT1994807	hsa-miR-4667-5p	CLIP-seq
MIRT1994808	hsa-miR-4692	CLIP-seq
MIRT1994809	hsa-miR-4700-5p	CLIP-seq
MIRT1994810	hsa-miR-4725-3p	CLIP-seq
MIRT1994811	hsa-miR-4742-5p	CLIP-seq
MIRT1994812	hsa-miR-4771	CLIP-seq
MIRT1994813	hsa-miR-4772-5p	CLIP-seq
MIRT2228939	hsa-miR-4789-5p	CLIP-seq
MIRT2449602	hsa-miR-4273	CLIP-seq
MIRT2449603	hsa-miR-4677-5p	CLIP-seq
MIRT2449604	hsa-miR-578	CLIP-seq
MIRT2449602	hsa-miR-4273	CLIP-seq
MIRT2449603	hsa-miR-4677-5p	CLIP-seq
MIRT2449604	hsa-miR-578	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002638	Process	Negative regulation of immunoglobulin production	IDA	23857366
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0009986	Component	Cell surface	IDA	16849395
GO:0019900	Function	Kinase binding	IPI	19843936
GO:0019902	Function	Phosphatase binding	IPI	19843936
GO:0019903	Function	Protein phosphatase binding	IPI	12051764
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	23857366
GO:0034163	Process	Regulation of toll-like receptor 9 signaling pathway	IDA	23857366
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23857366
GO:0045577	Process	Regulation of B cell differentiation	IDA	23857366
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	19843936
GO:0050864	Process	Regulation of B cell activation	IDA	23857366
GO:0090279	Process	Regulation of calcium ion import	IDA	19843936
GO:1905184	Process	Positive regulation of protein serine/threonine phosphatase activity	IDA	12051764
GO:1990782	Function	Protein tyrosine kinase binding	IPI	12051764

MIM	HGNC	e!Ensembl
606510	18506	ENSG00000160856

Protein

UniProt ID

Q96P31

Protein name

Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (MAIA) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)

Protein function

Promotes TLR9-induced B-cell proliferation, activation and survival but inhibits antibody production and suppresses plasma cell differentiation. Enhances activation of NF-kappa-B and MAPK signaling pathways in TLR9 stimulated B-cells (PubMed:238

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	101 → 185	Immunoglobulin domain	Domain
PF13895	Ig_2	191 → 280	Immunoglobulin domain	Domain
PF00047	ig	292 → 370	Immunoglobulin domain	Domain
PF13895	Ig_2	382 → 471	Immunoglobulin domain	Domain
PF13895	Ig_2	475 → 562	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Low expression on transitional B cells which increases to higher surface expression on mature and memory B-cells with innate-like features (at protein leve

Sequence

MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYH
DEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
QGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
LNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWS
RSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLI
EGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAA
DNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTL
RAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSG
NYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARAR
RKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNP
IYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
NYENVPRVLLASDH

Sequence length

734

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Immunoglobulin a deficiency	Immunoglobulin A deficiency (disorder)	rs72553883, rs72553882, rs144718007	27723758
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	26920376
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	24532676

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Biliary Cholangitis	Biliary Cholangitis	GWAS
Dementia	Dementia	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	15838509, 16176992, 16859508, 17133579, 17179172, 20190142, 22392608, 29193869
Asthma	Associate	31945409
Autoimmune Diseases	Associate	17868046, 19050767, 19452015, 20190142, 20626413, 25594855, 26334889, 32023449
Behcet Syndrome	Associate	19050767, 37264476
Breast Neoplasms	Associate	28059167
Congenital myasthenic syndrome with episodic apnea	Associate	25829454
Demyelinating Diseases	Associate	26402798
Endometriosis	Associate	22341374, 23553198, 26334889
Graves Disease	Associate	23505439, 27863461
Hepatitis C	Associate	24504816
Infertility	Associate	22341374, 23553198
Inflammation	Associate	32023449
Leukemia Lymphocytic Chronic B Cell	Associate	18314442
Lupus Erythematosus Systemic	Associate	15838509, 17133581, 38461541
Multiple Sclerosis	Associate	26402798, 33037294, 36759259
Multiple Sclerosis	Inhibit	36864689
Neoplasms	Stimulate	23792457
Neoplasms	Associate	30638415, 32023449
Neuromyelitis Optica	Associate	26402798
NOG Related Symphalangism Spectrum Disorder	Associate	27766406
Osteoarthritis	Associate	31945409
Rhinitis Allergic	Associate	25594855
Sezary Syndrome	Associate	23792457, 30638415
Thyroiditis Autoimmune	Associate	15838509, 17133579, 17133581, 17952073, 37197658

FCRL3 (Fc receptor like 3)