FCRL3 (Fc receptor like 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
115352
Gene name Gene Name - the full gene name approved by the HGNC.
Fc receptor like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCRL3
Synonyms (NCBI Gene) Gene synonyms aliases
CD307c, FCRH3, IFGP3, IRTA3, MAIA, SPAP2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(31)
miRTarBase ID miRNA Experiments Reference
MIRT994140 hsa-miR-1270 CLIP-seq
MIRT994141 hsa-miR-1273g CLIP-seq
MIRT994142 hsa-miR-185 CLIP-seq
MIRT994143 hsa-miR-3925-5p CLIP-seq
MIRT994144 hsa-miR-4306 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0002638 Process Negative regulation of immunoglobulin production IDA 23857366
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005515 Function Protein binding IPI 12051764, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606510 18506 ENSG00000160856
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96P31
Protein name Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (MAIA) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)
Protein function Promotes TLR9-induced B-cell proliferation, activation and survival but inhibits antibody production and suppresses plasma cell differentiation. Enhances activation of NF-kappa-B and MAPK signaling pathways in TLR9 stimulated B-cells (PubMed:238
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 101 → 185 Immunoglobulin domain Domain
PF13895 Ig_2 191 → 280 Immunoglobulin domain Domain
PF00047 ig 292 → 370 Immunoglobulin domain Domain
PF13895 Ig_2 382 → 471 Immunoglobulin domain Domain
PF13895 Ig_2 475 → 562 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Low expression on transitional B cells which increases to higher surface expression on mature and memory B-cells with innate-like features (at protein leve
Sequence 
MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYH
DEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
QGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
LNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWS
RSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLI
EGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAA
DNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTL
RAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSG
NYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARAR
RKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNP
IYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
NYENVPRVLLASDH
Sequence length 734
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Show/Hide Text Mining Associations (24)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 15838509, 16176992, 16859508, 17133579, 17179172, 20190142, 22392608, 29193869
Asthma Associate 31945409
Autoimmune Diseases Associate 17868046, 19050767, 19452015, 20190142, 20626413, 25594855, 26334889, 32023449
Behcet Syndrome Associate 19050767, 37264476
Breast Neoplasms Associate 28059167
Congenital myasthenic syndrome with episodic apnea Associate 25829454
Demyelinating Diseases Associate 26402798
Endometriosis Associate 22341374, 23553198, 26334889
Graves Disease Associate 23505439, 27863461
Hepatitis C Associate 24504816