Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
115350
Gene name Gene Name - the full gene name approved by the HGNC.
Fc receptor like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCRL1
Synonyms (NCBI Gene) Gene synonyms aliases
CD307a, FCRH1, IFGP1, IRTA5
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transm
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT994071 hsa-miR-1261 CLIP-seq
MIRT994072 hsa-miR-1269 CLIP-seq
MIRT994073 hsa-miR-1269b CLIP-seq
MIRT994074 hsa-miR-1278 CLIP-seq
MIRT994075 hsa-miR-1285 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
GO:0007166 Process Cell surface receptor signaling pathway IBA
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606508 18509 ENSG00000163534
Protein
UniProt ID Q96LA6
Protein name Fc receptor-like protein 1 (FcR-like protein 1) (FcRL1) (Fc receptor homolog 1) (FcRH1) (IFGP family protein 1) (hIFGP1) (Immune receptor translocation-associated protein 5) (CD antigen CD307a)
Protein function Type I transmembrane surface glycoprotein preferentially expressed by B-cells that regulates BCR-mediated signaling responses (PubMed:15479727). Recruits ABL1 as the intracellular effector molecule to enhance B-cell activation (By similarity). A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 18 105 Immunoglobulin domain Domain
PF13927 Ig_3 113 187 Domain
PF17736 Ig_C17orf99 217 296 C17orf99 Ig domain Domain
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression
Sequence
MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRA
LGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINV
HRVPVADVSLETQPP
GGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQ
YYCVAEN
GYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILY
WFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTV
PTGA
RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLPQEFTYLNSP
TPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI
TDVDYEDAM
Sequence length 429
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 32366930
Breast Neoplasms Inhibit 37684436
Carcinoma Hepatocellular Associate 23950870
Cardiotoxicity Inhibit 37684436
Dystonic Disorders Associate 31640787
Fibrous Dysplasia Polyostotic Associate 31819081
Hepatitis C Associate 24504816
Leukemia Lymphocytic Chronic B Cell Associate 18314442, 29476700
Lymphoma B Cell Associate 29476700
Lymphoma Large B Cell Diffuse Stimulate 39941037