Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	115111
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 26 member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC26A7
Synonyms (NCBI Gene) Gene synonyms aliases	SUT2
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in gene structure and protein length yet have markedly different tissue expression patterns. This gene has abundant and specific expression in the ki

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs774517670	C>T	Likely-pathogenic	Stop gained, coding sequence variant

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018335	hsa-miR-335-5p	Microarray	18185580
MIRT023903	hsa-miR-1-3p	Microarray	18668037
MIRT653673	hsa-miR-409-3p	HITS-CLIP	23824327
MIRT653672	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT653671	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT653670	hsa-miR-4307	HITS-CLIP	23824327
MIRT653669	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653668	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT653667	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT653666	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT653665	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT653673	hsa-miR-409-3p	HITS-CLIP	23824327
MIRT653672	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT653671	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT653670	hsa-miR-4307	HITS-CLIP	23824327
MIRT653669	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653668	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT653667	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT653666	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT653665	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1357932	hsa-miR-103a	CLIP-seq
MIRT1357933	hsa-miR-107	CLIP-seq
MIRT1357934	hsa-miR-1184	CLIP-seq
MIRT1357935	hsa-miR-1202	CLIP-seq
MIRT1357936	hsa-miR-151-3p	CLIP-seq
MIRT1357937	hsa-miR-19a	CLIP-seq
MIRT1357938	hsa-miR-19b	CLIP-seq
MIRT1357939	hsa-miR-3124-3p	CLIP-seq
MIRT1357940	hsa-miR-3194-5p	CLIP-seq
MIRT1357941	hsa-miR-338-3p	CLIP-seq
MIRT1357942	hsa-miR-34b	CLIP-seq
MIRT1357943	hsa-miR-3662	CLIP-seq
MIRT1357944	hsa-miR-3972	CLIP-seq
MIRT1357945	hsa-miR-4330	CLIP-seq
MIRT1357946	hsa-miR-4418	CLIP-seq
MIRT1357947	hsa-miR-4698	CLIP-seq
MIRT1357948	hsa-miR-4699-5p	CLIP-seq
MIRT1357949	hsa-miR-4709-3p	CLIP-seq
MIRT1357950	hsa-miR-4720-3p	CLIP-seq
MIRT1357951	hsa-miR-4757-5p	CLIP-seq
MIRT1357952	hsa-miR-4764-3p	CLIP-seq
MIRT1357953	hsa-miR-4775	CLIP-seq
MIRT1357954	hsa-miR-4804-3p	CLIP-seq
MIRT1357955	hsa-miR-491-3p	CLIP-seq
MIRT1357956	hsa-miR-509-3-5p	CLIP-seq
MIRT1357957	hsa-miR-509-5p	CLIP-seq
MIRT1357958	hsa-miR-541	CLIP-seq
MIRT1357959	hsa-miR-629	CLIP-seq
MIRT1357960	hsa-miR-640	CLIP-seq
MIRT1357961	hsa-miR-654-5p	CLIP-seq
MIRT1357947	hsa-miR-4698	CLIP-seq
MIRT2330365	hsa-miR-4318	CLIP-seq
MIRT2330366	hsa-miR-4693-5p	CLIP-seq
MIRT2330367	hsa-miR-550b	CLIP-seq
MIRT2330368	hsa-miR-892a	CLIP-seq
MIRT2459634	hsa-miR-3148	CLIP-seq
MIRT2459635	hsa-miR-4276	CLIP-seq
MIRT2459636	hsa-miR-570	CLIP-seq
MIRT1357941	hsa-miR-338-3p	CLIP-seq
MIRT2691033	hsa-miR-4530	CLIP-seq
MIRT2691034	hsa-miR-4672	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0005254	Function	Chloride channel activity	IDA	1183472
GO:0005737	Component	Cytoplasm	IDA	16524946
GO:0005768	Component	Endosome	IDA	16524946
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006811	Process	Ion transport	TAS
GO:0006820	Process	Anion transport	IDA	11834742
GO:0006821	Process	Chloride transport	IDA	1183472
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0008272	Process	Sulfate transport	IDA	1183472
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IBA	21873635
GO:0015106	Function	Bicarbonate transmembrane transporter activity	ISS	12736153
GO:0015108	Function	Chloride transmembrane transporter activity	IBA	21873635
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA	21873635
GO:0015116	Function	Sulfate transmembrane transporter activity	IDA	1183472
GO:0015301	Function	Anion:anion antiporter activity	IBA	21873635
GO:0015701	Process	Bicarbonate transport	ISS	12736153
GO:0016323	Component	Basolateral plasma membrane	IBA	21873635
GO:0016323	Component	Basolateral plasma membrane	IMP	16524946
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA	21873635
GO:0019531	Function	Oxalate transmembrane transporter activity	IDA	1183472
GO:0019532	Process	Oxalate transport	IDA	1183472
GO:0055038	Component	Recycling endosome membrane	IEA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
608479	14467	ENSG00000147606

Protein

UniProt ID

Q8TE54

Protein name

Anion exchange transporter (Solute carrier family 26 member 7)

Protein function

Acts as an anion channel mediating the transport of chloride, sulfate and oxalate ions (PubMed:11834742). Mediates the transport of bromide, iodide, nitrate, gluconate, thiocyanate and bicarbonate ions (By similarity). Its permeability towards b

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	47 → 444	Sulfate permease family	Family
PF01740	STAS	493 → 637	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the thyroid gland (at protein level). Expressed in tonsillar high endothelial venule endothelial cells (HEVEC), placenta and in testis, expressed in a subgroup of basal cells in the epididymal ducts. {ECO:0000269|PubMed:11

Sequence

MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV

Sequence length

656

Interactions

View interactions

	KEGG		Reactome
	Gastric acid secretion		Multifunctional anion exchangers

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21822266

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Congenital Hypothyroidism	congenital hypothyroidism			GenCC

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	34516545
Autoimmune Diseases	Associate	34944008
Congenital Hypothyroidism	Associate	34200080
Diarrhea	Associate	34270794
Hand Foot Syndrome	Associate	34270794
HIV Infections	Associate	21897333
Nausea	Associate	34270794
Neuroendocrine Tumors	Associate	34944008
Thyroid Cancer Papillary	Associate	36465624
Thyroid Carcinoma Anaplastic	Associate	27796151
Vomiting	Associate	34270794

SLC26A7 (solute carrier family 26 member 7)