Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	115106
Gene name	HAUS augmin like complex subunit 1
Gene symbol	HAUS1
Synonyms (NCBI Gene)	CCDC5HEI-CHEICHsT1461
Chromosome	18
Chromosome location	18q21.1
Summary	HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb `augmentare,` meaning `to increase.` The augmin complex is a microtubule-binding co

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049760	hsa-miR-92a-3p	CLASH	23622248
MIRT1040993	hsa-miR-3125	CLIP-seq
MIRT1040994	hsa-miR-3133	CLIP-seq
MIRT1040995	hsa-miR-3148	CLIP-seq
MIRT1040996	hsa-miR-3916	CLIP-seq
MIRT1040997	hsa-miR-4480	CLIP-seq
MIRT1040998	hsa-miR-4496	CLIP-seq
MIRT2544579	hsa-miR-3119	CLIP-seq
MIRT2544580	hsa-miR-889	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	19369198, 20360068, 21516116, 23455924, 25173975, 25281560, 25416956, 26638075, 27107012, 28514442, 29892012, 30723163, 31515488, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007098	Process	Centrosome cycle	IBA
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0007098	Process	Centrosome cycle	NAS	20360068
GO:0010968	Process	Regulation of microtubule nucleation	NAS	30044976
GO:0051225	Process	Spindle assembly	IBA
GO:0051225	Process	Spindle assembly	IEA
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051225	Process	Spindle assembly	NAS	20360068
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IBA
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0070652	Component	HAUS complex	IEA
GO:0070652	Component	HAUS complex	IPI	20360068
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

MIM	HGNC	e!Ensembl
608775	25174	ENSG00000152240

Q96CS2

Protein name

HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C)

Protein function

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.

PDB

7SQK

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta. {ECO:0000269|PubMed:15082789}.

Sequence

MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQ
KASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVN
DLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQ
NMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLES
YLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL

Sequence length

278

Interactions

View interactions

	Reactome
			Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane AURKA Activation by TPX2

HAUS1 (HAUS augmin like complex subunit 1)