HAUS1 (HAUS augmin like complex subunit 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
115106
Gene name Gene Name - the full gene name approved by the HGNC.
HAUS augmin like complex subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HAUS1
Synonyms (NCBI Gene) Gene synonyms aliases
CCDC5, HEI-C, HEIC, HsT1461
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb `augmentare,` meaning `to increase.` The augmin complex is a microtubule-binding co
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT049760 hsa-miR-92a-3p CLASH 23622248
MIRT1040993 hsa-miR-3125 CLIP-seq
MIRT1040994 hsa-miR-3133 CLIP-seq
MIRT1040995 hsa-miR-3148 CLIP-seq
MIRT1040996 hsa-miR-3916 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000922 Component Spindle pole IEA
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 19369198, 20360068, 21516116, 23455924, 25173975, 25416956, 26638075, 27107012, 28514442, 29892012, 30723163, 31515488, 32296183, 32814053
GO:0005813 Component Centrosome IDA 21399614
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608775 25174 ENSG00000152240
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96CS2
Protein name HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C)
Protein function Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
PDB 7SQK
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta. {ECO:0000269|PubMed:15082789}.
Sequence 
MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQ
KASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVN
DLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQ
NMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLES
YLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
Sequence length 278
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Migraine Migraine Disorders rs794727411 23793025
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Lymphoma Non Hodgkin Associate 37161065