CIDEA (cell death inducing DFFA like effector a)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1149
Gene name Gene Name - the full gene name approved by the HGNC.
Cell death inducing DFFA like effector a
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CIDEA
Synonyms (NCBI Gene) Gene synonyms aliases
CIDE-A
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18p11.21|18
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT019409 hsa-miR-148b-3p Microarray 17612493
MIRT2200858 hsa-miR-421 CLIP-seq
MIRT2200859 hsa-miR-4422 CLIP-seq
MIRT2200860 hsa-miR-4803 CLIP-seq
MIRT2200861 hsa-miR-543 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(25)
GO ID Ontology Definition Evidence Reference
GO:0001659 Process Temperature homeostasis ISS
GO:0001818 Process Negative regulation of cytokine production IMP 15919794
GO:0005634 Component Nucleus ISS 17080483
GO:0005737 Component Cytoplasm ISS 17080483
GO:0005739 Component Mitochondrion ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604440 1976 ENSG00000176194
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O60543
Protein name Lipid transferase CIDEA (Cell death activator CIDE-A) (Cell death-inducing DFFA-like effector A)
Protein function Lipid transferase that promotes unilocular lipid droplet formation by mediating lipid droplet fusion (PubMed:19843876, PubMed:26118629). Lipid droplet fusion promotes their enlargement, restricting lipolysis and favoring lipid storage (PubMed:19
PDB 2EEL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02017 CIDE-N 34 → 109 CIDE-N domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in omental and subcutaneous adipose tissue (at protein level). {ECO:0000269|PubMed:18509062}.
Sequence 
MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELIS
KTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSP
PKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYS
AQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Sequence length 219
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  AMPK signaling pathway   Lipid particle organization
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 20975297
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 26670611 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 26670611 ClinVar
Myocardial infarction Myocardial Failure 26670611 ClinVar
Show/Hide Text Mining Associations (15)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 20205715
Dermatitis Atopic Inhibit 35462437
Diabetes Mellitus Type 2 Associate 37597213
Endometrial Neoplasms Associate 20211485
Hypertrophy Inhibit 34672413
Insulin Resistance Associate 24983748
Insulin Resistance Inhibit 34672413
Myotonic Dystrophy Inhibit 36931749
Obesity Associate 19661960, 24983748, 34672413, 36931749, 37597213
Obesity Stimulate 19661960