OSBPL10 (oxysterol binding protein like 10)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114884
Gene name Gene Name - the full gene name approved by the HGNC.
Oxysterol binding protein like 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OSBPL10
Synonyms (NCBI Gene) Gene synonyms aliases
ORP10, OSBP9
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p23-p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like stero
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(797)
miRTarBase ID miRNA Experiments Reference
MIRT020572 hsa-miR-155-5p Proteomics 18668040
MIRT023671 hsa-miR-1-3p Proteomics 18668040
MIRT024715 hsa-miR-215-5p Microarray 19074876
MIRT026342 hsa-miR-192-5p Microarray 19074876
MIRT027577 hsa-miR-98-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0001786 Function Phosphatidylserine binding IDA 23934110
GO:0005515 Function Protein binding IPI 19615732, 22906437
GO:0005548 Function Phospholipid transporter activity TAS
GO:0005829 Component Cytosol IBA 21873635
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606738 16395 ENSG00000144645
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9BXB5
Protein name Oxysterol-binding protein-related protein 10 (ORP-10) (OSBP-related protein 10)
Protein function Probable lipid transporter involved in lipid countertransport between the endoplasmic reticulum and the plasma membrane. Its ability to bind phosphatidylserine, suggests that it specifically exchanges phosphatidylserine with phosphatidylinositol
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15409 PH_8 79 → 170 Pleckstrin homology domain Domain
PF01237 Oxysterol_BP 402 → 762 Oxysterol-binding protein Family
Sequence 
MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGS
VAASPSGGGGRRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRG
VLSLSGAIVSLSDEAPHMLVVYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKS
APSSRSRSLTLLPHGTPNSASPCSQRHLSVGAPGVVTITHHKSPAAARRAKSQYSGQLHE
VREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSV
HQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTS
QPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPT
FILEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYN
PIIGETFHCSWEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPIS
CFYCECEEKRLCVNTHVWTKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSIL
TIPWVELGGKVSINCAKTGYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWN
GTLEFTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRNLWREVTRYLRLGDIDAATEQ
KRHLEEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH
Sequence length 764
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Acyl chain remodelling of PS
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 30285260, 28991256
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 26474971
Carcinoma Hepatocellular Associate 36918840
Hyperlipidemia Familial Combined Associate 19554302
Hyperlipidemias Associate 24347629
Neoplasms Associate 26491211, 36918840
Periodontitis Associate 23066400
Peripheral Arterial Disease Associate 20610895
Prostatic Neoplasms Associate 26491211
Prostatitis Associate 26491211
Tuberculosis Associate 35150890