Gene Gene information from NCBI Gene database.
Entrez ID 114836
Gene name SLAM family member 6
Gene symbol SLAMF6
Synonyms (NCBI Gene)
CD352KALIKALIbLy108NTB-ANTBASF2000
Chromosome 1
Chromosome location 1q23.2-q23.3
Summary The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and
miRNA miRNA information provided by mirtarbase database.
82
miRTarBase ID miRNA Experiments Reference
MIRT1351478 hsa-let-7a CLIP-seq
MIRT1351479 hsa-let-7b CLIP-seq
MIRT1351480 hsa-let-7c CLIP-seq
MIRT1351481 hsa-let-7d CLIP-seq
MIRT1351482 hsa-let-7e CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 11489943, 16920955, 22912825, 23346089, 24688028, 32296183
GO:0005886 Component Plasma membrane IDA 22184727
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606446 21392 ENSG00000162739
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96DU3
Protein name SLAM family member 6 (Activating NK receptor) (NK-T-B-antigen) (NTB-A) (CD antigen CD352)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 2IF7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 127 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes (PubMed:11489943). Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients (PubMed:22184727). {ECO:0000269|PubMed:1
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS
SYTLRIL
RQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF
IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP
RENDTITIYSTINHSKESKPTFSRATALDNVV
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell