Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	114836
Gene name Gene Name - the full gene name approved by the HGNC.	SLAM family member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLAMF6
Synonyms (NCBI Gene) Gene synonyms aliases	CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.2-q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and

Show/Hide all(82)

miRTarBase ID	miRNA	Experiments
MIRT1351478	hsa-let-7a	CLIP-seq
MIRT1351479	hsa-let-7b	CLIP-seq
MIRT1351480	hsa-let-7c	CLIP-seq
MIRT1351481	hsa-let-7d	CLIP-seq
MIRT1351482	hsa-let-7e	CLIP-seq
MIRT1351483	hsa-let-7f	CLIP-seq
MIRT1351484	hsa-let-7g	CLIP-seq
MIRT1351485	hsa-let-7i	CLIP-seq
MIRT1351486	hsa-miR-202	CLIP-seq
MIRT1351487	hsa-miR-3927	CLIP-seq
MIRT1351488	hsa-miR-4303	CLIP-seq
MIRT1351489	hsa-miR-4451	CLIP-seq
MIRT1351490	hsa-miR-4458	CLIP-seq
MIRT1351491	hsa-miR-4500	CLIP-seq
MIRT1351492	hsa-miR-4649-3p	CLIP-seq
MIRT1351493	hsa-miR-4762-3p	CLIP-seq
MIRT1351494	hsa-miR-98	CLIP-seq
MIRT2104172	hsa-miR-1236	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2104175	hsa-miR-24	CLIP-seq
MIRT2104176	hsa-miR-371-5p	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104178	hsa-miR-4284	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2328289	hsa-miR-1915	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2328290	hsa-miR-2861	CLIP-seq
MIRT2328291	hsa-miR-3187-3p	CLIP-seq
MIRT2328292	hsa-miR-3545-3p	CLIP-seq
MIRT2328293	hsa-miR-3663-5p	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2328295	hsa-miR-4435	CLIP-seq
MIRT2328296	hsa-miR-4512	CLIP-seq
MIRT2328297	hsa-miR-4635	CLIP-seq
MIRT2328298	hsa-miR-4680-5p	CLIP-seq
MIRT2328299	hsa-miR-4701-5p	CLIP-seq
MIRT2328300	hsa-miR-4715-5p	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2328301	hsa-miR-4726-3p	CLIP-seq
MIRT2328302	hsa-miR-4755-3p	CLIP-seq
MIRT2328303	hsa-miR-4768-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2328304	hsa-miR-548s	CLIP-seq
MIRT2328305	hsa-miR-588	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq
MIRT2328307	hsa-miR-665	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623076	hsa-miR-129-5p	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2623077	hsa-miR-3149	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2623078	hsa-miR-4735-5p	CLIP-seq
MIRT2623079	hsa-miR-4775	CLIP-seq
MIRT2623080	hsa-miR-4794	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623081	hsa-miR-590-3p	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq
MIRT2623076	hsa-miR-129-5p	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2623077	hsa-miR-3149	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2623078	hsa-miR-4735-5p	CLIP-seq
MIRT2623079	hsa-miR-4775	CLIP-seq
MIRT2623080	hsa-miR-4794	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623081	hsa-miR-590-3p	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11489943, 16920955, 22912825, 23346089, 24688028, 32296183
GO:0005886	Component	Plasma membrane	IDA	22184727
GO:0005886	Component	Plasma membrane	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0032729	Process	Positive regulation of interferon-gamma production	IMP	16920955
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	22184727
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	16920955
GO:0050776	Process	Regulation of immune response	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0072540	Process	T-helper 17 cell lineage commitment	IDA	22184727

MIM	HGNC	e!Ensembl
606446	21392	ENSG00000162739

Protein

UniProt ID

Q96DU3

Protein name

SLAM family member 6 (Activating NK receptor) (NK-T-B-antigen) (NTB-A) (CD antigen CD352)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

PDB

2IF7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	26 → 127	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes (PubMed:11489943). Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients (PubMed:22184727). {ECO:0000269|PubMed:1

Sequence

MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS
SYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF
IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP
RENDTITIYSTINHSKESKPTFSRATALDNVV

Sequence length

332

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Dermatitis	Dermatitis	GWAS

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining
Acrospiroma	Associate	40558528
Angina Pectoris	Associate	26823790
Arthritis Rheumatoid	Associate	32723749, 35016729
Autoimmune Diseases	Associate	22184727
Breast Neoplasms	Associate	34867821, 38287061
Carcinoma Hepatocellular	Associate	37861541
Carcinoma Renal Cell	Associate	31672930
Death	Associate	24688028
Diabetes Gestational	Associate	35370940
Glucosephosphate Dehydrogenase Deficiency	Associate	25793728
HIV Infections	Associate	17513617
Leukemia	Inhibit	15536144
Lupus Erythematosus Systemic	Associate	21231893, 35603218
Lupus Erythematosus Systemic	Stimulate	22184727, 22989874
Lymphoproliferative Disorders	Inhibit	24688028
Melanoma	Associate	38287061, 40558528
Multiple Myeloma	Associate	26287276
Myocardial Infarction	Associate	26823790
Neoplasms	Associate	38287061, 40558528

SLAMF6 (SLAM family member 6)