Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114836
Gene name Gene Name - the full gene name approved by the HGNC.
SLAM family member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLAMF6
Synonyms (NCBI Gene) Gene synonyms aliases
CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.2-q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1351478 hsa-let-7a CLIP-seq
MIRT1351479 hsa-let-7b CLIP-seq
MIRT1351480 hsa-let-7c CLIP-seq
MIRT1351481 hsa-let-7d CLIP-seq
MIRT1351482 hsa-let-7e CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 11489943, 16920955, 22912825, 23346089, 24688028, 32296183
GO:0005886 Component Plasma membrane IDA 22184727
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606446 21392 ENSG00000162739
Protein
UniProt ID Q96DU3
Protein name SLAM family member 6 (Activating NK receptor) (NK-T-B-antigen) (NTB-A) (CD antigen CD352)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 2IF7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 127 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes (PubMed:11489943). Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients (PubMed:22184727). {ECO:0000269|PubMed:1
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS
SYTLRIL
RQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF
IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP
RENDTITIYSTINHSKESKPTFSRATALDNVV
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrospiroma Associate 40558528
Angina Pectoris Associate 26823790
Arthritis Rheumatoid Associate 32723749, 35016729
Autoimmune Diseases Associate 22184727
Breast Neoplasms Associate 34867821, 38287061
Carcinoma Hepatocellular Associate 37861541
Carcinoma Renal Cell Associate 31672930
Death Associate 24688028
Diabetes Gestational Associate 35370940
Glucosephosphate Dehydrogenase Deficiency Associate 25793728