DTX2 (deltex E3 ubiquitin ligase 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
113878
Gene name Gene Name - the full gene name approved by the HGNC.
Deltex E3 ubiquitin ligase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DTX2
Synonyms (NCBI Gene) Gene synonyms aliases
RNF58
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(81)
miRTarBase ID miRNA Experiments Reference
MIRT050508 hsa-miR-20a-5p CLASH 23622248
MIRT486947 hsa-miR-6808-5p PAR-CLIP 23592263
MIRT486946 hsa-miR-6893-5p PAR-CLIP 23592263
MIRT486944 hsa-miR-940 PAR-CLIP 23592263
MIRT486945 hsa-miR-4716-3p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19549727, 21516116, 24722188, 25416956, 25910212, 31515488, 32296183
GO:0005654 Component Nucleoplasm IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0007219 Process Notch signaling pathway IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
613141 15973 ENSG00000091073
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86UW9
Protein name Probable E3 ubiquitin-protein ligase DTX2 (EC 2.3.2.27) (Protein deltex-2) (Deltex2) (hDTX2) (RING finger protein 58) (RING-type E3 ubiquitin transferase DTX2)
Protein function Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental
PDB 6IR0 , 6Y22 , 6Y2X , 6Y3J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02825 WWE 20 → 97 WWE domain Family
PF02825 WWE 110 → 174 WWE domain Family
PF00097 zf-C3HC4 412 → 472 Zinc finger, C3HC4 type (RING finger) Domain
PF18102 DTC 480 → 614 Deltex C-terminal domain Domain
Sequence 
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
Sequence length 622
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Notch signaling pathway   Activated NOTCH1 Transmits Signal to the Nucleus
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Brain neoplasms Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain 21127729 ClinVar
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 24023782
Leukemia Inhibit 37500075