VSIG4 (V-set and immunoglobulin domain containing 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 11326
Gene name V-set and immunoglobulin domain containing 4
Gene symbol VSIG4
Synonyms (NCBI Gene)
CRIgZ39IG
Chromosome X
Chromosome location Xq12
Summary This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for th
miRNA miRNA information provided by mirtarbase database.
26
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (26)
miRTarBase ID miRNA Experiments Reference
MIRT1487833 hsa-miR-1273f CLIP-seq
MIRT1487834 hsa-miR-143 CLIP-seq
MIRT1487835 hsa-miR-3126-3p CLIP-seq
MIRT1487836 hsa-miR-3128 CLIP-seq
MIRT1487837 hsa-miR-4470 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0001851 Function Complement component C3b binding IBA
GO:0001851 Function Complement component C3b binding IPI 17051150
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 16530040, 32296183
GO:0006957 Process Complement activation, alternative pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
300353 17032 ENSG00000155659
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y279
Protein name V-set and immunoglobulin domain-containing protein 4 (Protein Z39Ig)
Protein function Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
PDB 2ICC , 2ICE , 2ICF , 5IMK , 5IML , 8TE5 , 8TE6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 → 136 Immunoglobulin V-set domain Domain
PF13927 Ig_3 142 → 214 Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages. {ECO:0000269|PubMed:11004523, ECO:0000269|PubMed:17016562}.
Sequence 
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC
Sequence length 399
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Complement and coagulation cascades  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
14
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Benign rs142681306 RCV005907335
Gastric cancer Benign rs142681306 RCV005907337
Hepatocellular carcinoma Benign rs142681306 RCV005907336
VSIG4-related disorder Conflicting classifications of pathogenicity; Likely benign; Benign rs201236670, rs2519508248, rs754269568, rs768192114, rs34581041, rs2519509632, rs373148029, rs199904204, rs201039111, rs749453785, rs749607769 RCV003963729
RCV003909458
RCV003912184
RCV003912279
RCV003942044
RCV003943981
RCV003949756
RCV003934720
RCV003969270
RCV003946970
RCV003954372
Show/Hide Text Mining Associations (34)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Psoriatic Associate 18727628
Arthritis Rheumatoid Associate 18727628
Atherosclerosis Associate 36644582
Atrial Fibrillation Associate 36644582
Breast Neoplasms Associate 37684436
Calcinosis Associate 37163449
Carcinoma Pancreatic Ductal Associate 37097516
Carcinoma Renal Cell Associate 31886185, 39871215
Cardiotoxicity Stimulate 37684436
Diabetic Nephropathies Associate 34124269