VSIG4 (V-set and immunoglobulin domain containing 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11326
Gene name Gene Name - the full gene name approved by the HGNC.
V-set and immunoglobulin domain containing 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VSIG4
Synonyms (NCBI Gene) Gene synonyms aliases
CRIg, Z39IG
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for th
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
miRTarBase ID miRNA Experiments Reference
MIRT1487833 hsa-miR-1273f CLIP-seq
MIRT1487834 hsa-miR-143 CLIP-seq
MIRT1487835 hsa-miR-3126-3p CLIP-seq
MIRT1487836 hsa-miR-3128 CLIP-seq
MIRT1487837 hsa-miR-4470 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0001851 Function Complement component C3b binding IBA 21873635
GO:0001851 Function Complement component C3b binding IPI 17051150
GO:0005515 Function Protein binding IPI 32296183
GO:0006957 Process Complement activation, alternative pathway IEA
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
300353 17032 ENSG00000155659
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y279
Protein name V-set and immunoglobulin domain-containing protein 4 (Protein Z39Ig)
Protein function Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
PDB 2ICC , 2ICE , 2ICF , 5IMK , 5IML , 8TE5 , 8TE6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 → 136 Immunoglobulin V-set domain Domain
PF13927 Ig_3 142 → 214 Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages. {ECO:0000269|PubMed:11004523, ECO:0000269|PubMed:17016562}.
Sequence 
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC
Sequence length 399
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Complement and coagulation cascades  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Glomerulonephritis IGA Glomerulonephritis rs778043831 25133636
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 18206229
Show/Hide Text Mining Associations (34)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Psoriatic Associate 18727628
Arthritis Rheumatoid Associate 18727628
Atherosclerosis Associate 36644582
Atrial Fibrillation Associate 36644582
Breast Neoplasms Associate 37684436
Calcinosis Associate 37163449
Carcinoma Pancreatic Ductal Associate 37097516
Carcinoma Renal Cell Associate 31886185, 39871215
Cardiotoxicity Stimulate 37684436
Diabetic Nephropathies Associate 34124269