Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11322
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane channel like 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMC6
Synonyms (NCBI Gene) Gene synonyms aliases
EV1, EVER1, EVIN1, LAK-4P, TNRC6C-AS1, lnc
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908327 G>A Risk-factor 5 prime UTR variant, upstream transcript variant, stop gained, coding sequence variant, genic upstream transcript variant, non coding transcript variant
rs121908328 C>A,T Risk-factor Intron variant, stop gained, coding sequence variant, non coding transcript variant, missense variant
rs121908329 G>T Risk-factor Coding sequence variant, intron variant, non coding transcript variant, stop gained
rs754288317 C>T Likely-pathogenic Splice acceptor variant, genic upstream transcript variant, upstream transcript variant
rs769471844 T>A,C Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017951 hsa-miR-335-5p Microarray 18185580
MIRT044869 hsa-miR-195-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 18158319, 30068544, 32296183, 32814053, 32917726
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 12426567
GO:0005783 Component Endoplasmic reticulum IDA 12426567, 18158319
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605828 18021 ENSG00000141524
Protein
UniProt ID Q7Z403
Protein name Transmembrane channel-like protein 6 (Epidermodysplasia verruciformis protein 1) (Protein LAK-4)
Protein function Acts as a regulatory protein involved in the regulation of numerous cellular processes (PubMed:18158319, PubMed:30068544, PubMed:32917726). Together with its homolog TMC8/EVER2, forms a complex with CIB1 in lymphocytes and keratynocytes where TM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07810 TMC 540 646 TMC domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, prostate, testis, activated T-lymphocytes and lymphokine-activated killer (LAK) lymphocytes. {ECO:0000269|PubMed:12906855, ECO:0000269|Ref.3}.
Sequence
MAQPLAFILDVPETPGDQGQGPSPYDESEVHDSFQQLIQEQSQCTAQEGLELQQREREVT
GSSQQTLWRPEGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRPLLGNF
VRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLRE
KSRTPRGKWRGQPGSGGVCSCCGRLRYACVLALHSLGLALLSALQALMPWRYALKRIGGQ
FGSSVLSYFLFLKTLLAFNALLLLLLVAFIMGPQVAFPPALPGPAPVCTGLELLTGAGCF
THTVMYYGHYSNATLNQPCGSPLDGSQCTPRVGGLPYNMPLAYLSTVGVSFFITCITLVY
SMAHSFGESYRVGSTSGIHAITVFCSWDYKVTQKRASRLQQDNIRTRLKELLAEWQLRHS
PRSVCGRLRQAAVLGLVWLLCLGTALGCAVAVHVFSEFMIQSPEAAGQEAVLLVLPLVVG
LLNLGAPYLCRVLAALEPHDSPVLEVYVAICRNLILKLAILGTLCYHWLGRRVGVLQGQC
WEDFVGQELYRFLVMDFVLMLLDTLFGELVWRIISEKKLKRRRKPEFDIARNVLELIYGQ
TLTWLGVLFSPLLPAVQIIKLLLVFYVKKTSLLANCQAPRRPWLAS
HMSTVFLTLLCFPA
FLGAAVFLCYAVWQVKPSSTCGPFRTLDTMYEAGRVWVRHLEAAGPRVSWLPWVHRYLME
NTFFVFLVSALLLAVIYLNIQVVRGQRKVICLLKEQISNEGEDKIFLINKLHSIYERKER
EERSRVGTTEEAAAPPALLTDEQDA
Sequence length 805
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epidermodysplasia Verruciformis epidermodysplasia verruciformis, Epidermodysplasia verruciformis, susceptibility to, 1 rs202217062, rs121908327, rs121908329, rs769471844, rs1555655146, rs1567989416, rs1567997496, rs1392702424 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 34136741
Carcinoma Renal Cell Associate 37468683
Carcinoma Squamous Cell Associate 25853559
Cystic Fibrosis Associate 26047157
Dystonic Disorders Associate 22952854
Epidermodysplasia Verruciformis Associate 10084299, 10844558, 17139267, 18158319, 18224692, 21387292, 22952854, 25378492, 25853559, 30068544, 32917957, 33818984, 35154113, 36602881
Immune System Diseases Associate 35154113
Papillomavirus Infections Associate 25853559
Pseudomonas Infections Associate 26047157
Psoriasis Associate 10084299