Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11309
Gene name	Solute carrier organic anion transporter family member 2B1
Gene symbol	SLCO2B1
Synonyms (NCBI Gene)	OATP-BOATP2B1OATPBSLC21A9
Chromosome	11
Chromosome location	11q13.4
Summary	This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have be

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT504692	hsa-miR-4673	PAR-CLIP	21572407
MIRT504691	hsa-miR-640	PAR-CLIP	21572407
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT504692	hsa-miR-4673	PAR-CLIP	22012620
MIRT504691	hsa-miR-640	PAR-CLIP	22012620
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT504692	hsa-miR-4673	PAR-CLIP	21572407
MIRT504691	hsa-miR-640	PAR-CLIP	21572407
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT504692	hsa-miR-4673	PAR-CLIP	22012620
MIRT504691	hsa-miR-640	PAR-CLIP	22012620
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT1369343	hsa-miR-3182	CLIP-seq
MIRT1369344	hsa-miR-3686	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369346	hsa-miR-4287	CLIP-seq
MIRT1369347	hsa-miR-4685-3p	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369350	hsa-miR-3145-3p	CLIP-seq
MIRT1369351	hsa-miR-4330	CLIP-seq
MIRT1369352	hsa-miR-4477a	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT2440556	hsa-miR-4493	CLIP-seq
MIRT2440557	hsa-miR-4635	CLIP-seq
MIRT2440558	hsa-miR-4650-5p	CLIP-seq
MIRT2440559	hsa-miR-4757-5p	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT2627308	hsa-miR-2681	CLIP-seq
MIRT2627309	hsa-miR-299-3p	CLIP-seq
MIRT2627310	hsa-miR-3153	CLIP-seq
MIRT2627311	hsa-miR-3607-5p	CLIP-seq
MIRT2627312	hsa-miR-4648	CLIP-seq
MIRT2627313	hsa-miR-4654	CLIP-seq
MIRT2627314	hsa-miR-4668-5p	CLIP-seq
MIRT2627315	hsa-miR-4769-5p	CLIP-seq
MIRT2691330	hsa-miR-125a-5p	CLIP-seq
MIRT2691331	hsa-miR-125b	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT2627308	hsa-miR-2681	CLIP-seq
MIRT2627309	hsa-miR-299-3p	CLIP-seq
MIRT2627310	hsa-miR-3153	CLIP-seq
MIRT2627311	hsa-miR-3607-5p	CLIP-seq
MIRT2691332	hsa-miR-3616-3p	CLIP-seq
MIRT2691333	hsa-miR-4319	CLIP-seq
MIRT2627312	hsa-miR-4648	CLIP-seq
MIRT2627313	hsa-miR-4654	CLIP-seq
MIRT2627314	hsa-miR-4668-5p	CLIP-seq
MIRT2691334	hsa-miR-4721	CLIP-seq
MIRT2691335	hsa-miR-4732-3p	CLIP-seq
MIRT2627315	hsa-miR-4769-5p	CLIP-seq
MIRT2691336	hsa-miR-544b	CLIP-seq
MIRT2691337	hsa-miR-670	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	21278488, 29752999, 29871943
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	10873595, 11159893, 11932330, 12409283, 12724351, 14610227, 16908597, 18501590, 19129463, 22021325, 22201122, 26383540, 27576593, 34628357
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	29871943
GO:0009925	Component	Basal plasma membrane	IDA	11159893, 11932330, 12409283, 12724351, 35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	10873595
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	18501590
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015711	Process	Organic anion transport	IDA	12724351, 22021325
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015732	Process	Prostaglandin transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	12724351
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0022857	Function	Transmembrane transporter activity	IDA	25132355
GO:0042167	Process	Heme catabolic process	TAS
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IDA	12724351, 29871943
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IMP	29752999
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653

MIM	HGNC	e!Ensembl
604988	10962	ENSG00000137491

O94956

Protein name

Solute carrier organic anion transporter family member 2B1 (Organic anion transporter B) (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Organic anion transporting polypeptide 2B1) (OATP2B1) (Solute carrier family

Protein function

Mediates the Na(+)-independent transport of steroid sulfate conjugates and other specific organic anions (PubMed:10873595, PubMed:11159893, PubMed:11932330, PubMed:12724351, PubMed:14610227, PubMed:16908597, PubMed:18501590, PubMed:20507927, Pub

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	50 → 647	Organic Anion Transporter Polypeptide (OATP) family	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in the liver, at the sinusoidal membrane of the hepatocytes (PubMed:10873595, PubMed:11159893, PubMed:23531488). Expressed in the kidney (PubMed:11159893). Expressed in placental trophoblasts and syncytiotrophoblast

Sequence

MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV

Sequence length

709

Interactions

View interactions

	KEGG		Reactome
	Folate transport and metabolism		Heme degradation Transport of organic anions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Atorvastatin response	-	rs12422149	RCV002291808
EBV-positive nodal T- and NK-cell lymphoma	Uncertain significance	rs140953109	RCV004557960

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	31545446
Asthma	Associate	19151602
Breast Neoplasms	Associate	17214375
Carcinoma Hepatocellular	Associate	21625523, 23352986, 29138286
Carcinoma Squamous Cell	Associate	33428598
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	32147459
Chemical and Drug Induced Liver Injury	Associate	31240859
Colorectal Neoplasms	Associate	34599518
Disease	Associate	28389510
Fatty Liver Alcoholic	Associate	28097795
Fibrosis	Stimulate	23462698
Fibrosis	Associate	34428046
Hemolytic Uremic Syndrome	Stimulate	33255902
Hepatolenticular Degeneration	Associate	34117631
Hypomagnesemia primary	Stimulate	30890759
Inflammatory Bowel Diseases	Stimulate	19487253
Kidney Failure Chronic	Associate	31664047
Myositis	Associate	28771594
Neoplasms	Associate	21383546, 22734885, 23137910, 28389510, 34428046
Neoplasms	Stimulate	32147459
Non alcoholic Fatty Liver Disease	Associate	27301979, 34428046
Pancreatic Neoplasms	Associate	21625523
Prostatic Neoplasms	Associate	21266523, 21606417, 26668348, 28389510, 30890759
Prostatic Neoplasms Castration Resistant	Associate	21266523
Prostatitis	Associate	32147459
Squamous Cell Carcinoma of Head and Neck	Associate	23137910
Thyroid Neoplasms	Associate	21625523

SLCO2B1 (solute carrier organic anion transporter family member 2B1)