HRH3 (histamine receptor H3)

Gene

• Entrez ID: 11255
• Gene name: Histamine receptor H3
• Gene symbol: HRH3
• Synonyms (NCBI Gene): GPCR97, HH3R
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756048	hsa-miR-4696	Microarray, qRT-PCR	35899934
MIRT756049	hsa-miR-1275	Microarray, qRT-PCR	35899934
MIRT1054689	hsa-miR-1207-5p	CLIP-seq
MIRT1054690	hsa-miR-2682	CLIP-seq
MIRT1054691	hsa-miR-3151	CLIP-seq
MIRT1054692	hsa-miR-34a	CLIP-seq
MIRT1054693	hsa-miR-34c-5p	CLIP-seq
MIRT1054694	hsa-miR-3714	CLIP-seq
MIRT1054695	hsa-miR-3918	CLIP-seq
MIRT1054696	hsa-miR-4447	CLIP-seq
MIRT1054697	hsa-miR-4472	CLIP-seq
MIRT1054698	hsa-miR-449a	CLIP-seq
MIRT1054699	hsa-miR-449b	CLIP-seq
MIRT1054700	hsa-miR-449c	CLIP-seq
MIRT1054701	hsa-miR-4763-3p	CLIP-seq
MIRT1054702	hsa-miR-486-3p	CLIP-seq
MIRT1054703	hsa-miR-491-5p	CLIP-seq
MIRT1054704	hsa-miR-545	CLIP-seq
MIRT1054705	hsa-miR-548an	CLIP-seq
MIRT2244734	hsa-miR-3925-3p	CLIP-seq
MIRT2244735	hsa-miR-455-3p	CLIP-seq
MIRT2451380	hsa-miR-1302	CLIP-seq
MIRT2451381	hsa-miR-3122	CLIP-seq
MIRT2451382	hsa-miR-3181	CLIP-seq
MIRT2451383	hsa-miR-3189-3p	CLIP-seq
MIRT2451384	hsa-miR-3649	CLIP-seq
MIRT2451385	hsa-miR-3913-5p	CLIP-seq
MIRT2451386	hsa-miR-4298	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004969	Function	Histamine receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	21873635
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007269	Process	Neurotransmitter secretion	TAS	10347254
GO:0014050	Process	Negative regulation of glutamate secretion	IBA	21873635
GO:0014061	Process	Regulation of norepinephrine secretion	IBA	21873635
GO:0014063	Process	Negative regulation of serotonin secretion	IBA	21873635
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA	21873635
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0050890	Process	Cognition	IBA	21873635
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 604525
• HGNC: 5184
• e!Ensembl: ENSG00000101180

Protein

• UniProt ID: Q9Y5N1
• Protein name: Histamine H3 receptor (H3R) (HH3R) (G-protein coupled receptor 97)
• Protein function: The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of
• PDB: 7F61, 8YN5, 8YN6, 8YN7, 8YN8, 8YUU, 8YUV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 412	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the CNS, with the greatest expression in the thalamus and caudate nucleus. The various isoforms are mainly coexpressed in brain, but their relative expression level varies in a region-specific manner. Isoform
• Sequence:

  MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
  ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
  SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
  SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
  GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
  ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
  AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
  RAFTKLLCPQKLKIQPHSSLEHCWK

• Sequence length: 445

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Histamine receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Hypertension	Hypertensive disease	rs13306026	9050021

Unknown
Disease term	Disease name	Evidence	References	Source
Oligodendroglioma	Oligodendroglioma			GWAS
Restless Legs Syndrome	Restless Legs Syndrome			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	29701013
Anaphylaxis	Associate	28465562
Anxiety	Associate	28969474
Autism Spectrum Disorder	Associate	35877665
Carcinoma Non Small Cell Lung	Stimulate	33159174
Cognition Disorders	Associate	37329185
Colorectal Neoplasms	Associate	36902343
Cystitis Interstitial	Associate	31718622
Diarrhea	Associate	28465562
Heart Failure	Associate	26989676
Heredodegenerative Disorders Nervous System	Associate	38159685
Inflammation	Associate	36902343
Lung Neoplasms	Associate	33159174
Narcolepsy	Associate	29701013
Neoplasm Metastasis	Associate	33159174
Neoplasms	Associate	17932461, 33159174
Neuroendocrine Tumors	Associate	28465562
Neurologic Manifestations	Associate	29701013, 38159685
Ovarian Neoplasms	Associate	35751684
Parkinson Disease	Associate	38159685
Psychotic Disorders	Associate	37329185
Schizophrenia	Associate	29701013, 37329185, 38159685