Gene Gene information from NCBI Gene database.
Entrez ID 11252
Gene name Protein kinase C and casein kinase substrate in neurons 2
Gene symbol PACSIN2
Synonyms (NCBI Gene)
SDPII
Chromosome 22
Chromosome location 22q13.2
Summary This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. Alternative splicing results in mul
miRNA miRNA information provided by mirtarbase database.
107
miRTarBase ID miRNA Experiments Reference
MIRT020597 hsa-miR-155-5p Proteomics 18668040
MIRT041342 hsa-miR-193b-3p CLASH 23622248
MIRT461118 hsa-miR-4433b-3p PAR-CLIP 23592263
MIRT461117 hsa-miR-3681-5p PAR-CLIP 23592263
MIRT461116 hsa-miR-6849-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
62
GO ID Ontology Definition Evidence Reference
GO:0002042 Process Cell migration involved in sprouting angiogenesis IEA
GO:0002042 Process Cell migration involved in sprouting angiogenesis ISS
GO:0002042 Process Cell migration involved in sprouting angiogenesis ISS
GO:0005515 Function Protein binding IPI 16189514, 16318909, 16551695, 20936779, 21044950, 23596323, 25036101, 25416956, 31413325, 32296183, 33961781, 35271311
GO:0005543 Function Phospholipid binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604960 8571 ENSG00000100266
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UNF0
Protein name Protein kinase C and casein kinase substrate in neurons protein 2 (Syndapin-2) (Syndapin-II) (SdpII)
Protein function Regulates the morphogenesis and endocytosis of caveolae (By similarity). Lipid-binding protein that is able to promote the tubulation of the phosphatidic acid-containing membranes it preferentially binds. Plays a role in intracellular vesicle-me
PDB 3ABH , 3ACO , 3HAJ , 3Q0K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00611 FCH 23 99 Fes/CIP4, and EFC/F-BAR homology domain Family
PF00018 SH3_1 432 479 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11082044, ECO:0000269|PubMed:11179684}.
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLE
VKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Sequence length 486
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Clathrin-mediated endocytosis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Myoepithelial tumor Uncertain significance rs2517954462 RCV002463898
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 36672180
Blast Crisis Associate 35352878
Brain Diseases Associate 36672180
Depressive Disorder Major Associate 36672180
Diabetes Mellitus Type 2 Associate 32041280
Drug Related Side Effects and Adverse Reactions Associate 27452984
Gastrointestinal Diseases Associate 22846425, 31792371
Hematologic Diseases Associate 27452984, 31792371
Inflammatory Bowel Diseases Associate 31792371
Leukemia Myelogenous Chronic BCR ABL Positive Associate 35352878