PTGDR2 (prostaglandin D2 receptor 2)

Gene

• Entrez ID: 11251
• Gene name: Prostaglandin D2 receptor 2
• Gene symbol: PTGDR2
• Synonyms (NCBI Gene): CD294, CRTH2, DL1R, DP2, GPR44
• Chromosome: 11
• Chromosome location: 11q12.2
• Summary: This gene encodes a G-protein-coupled receptor that is preferentially expressed in CD4+ effector T helper 2 (Th2) cells. This protein is a prostaglandin D2 receptor that mediates the pro-inflammatory chemotaxis of eosinophils, basophils, and Th2 lymphocyt

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT647268	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT647267	hsa-miR-520f-3p	HITS-CLIP	23824327
MIRT647266	hsa-miR-6715a-3p	HITS-CLIP	23824327
MIRT647265	hsa-miR-3183	HITS-CLIP	23824327
MIRT647264	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647263	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647262	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT647261	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT647260	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT647259	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT647258	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647257	hsa-miR-5695	HITS-CLIP	23824327
MIRT647256	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647255	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647254	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT647253	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647252	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT647251	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT647250	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT647249	hsa-miR-6715b-3p	HITS-CLIP	23824327
MIRT647248	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647247	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647246	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647245	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT647244	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT647243	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT647242	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT647241	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647240	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT647239	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT647268	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT647267	hsa-miR-520f-3p	HITS-CLIP	23824327
MIRT647266	hsa-miR-6715a-3p	HITS-CLIP	23824327
MIRT647265	hsa-miR-3183	HITS-CLIP	23824327
MIRT647264	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647263	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647262	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT647261	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT647260	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT647259	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT647258	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647257	hsa-miR-5695	HITS-CLIP	23824327
MIRT647256	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647255	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647254	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT647253	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647252	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT647251	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT647250	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT647249	hsa-miR-6715b-3p	HITS-CLIP	23824327
MIRT647248	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647247	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647246	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647245	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT647244	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT647243	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT647242	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT647241	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647240	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT647239	hsa-miR-1238-3p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
TBX21	Repression	14500650

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001785	Function	Prostaglandin J receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	11208866
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9973380
GO:0004953	Function	Icosanoid receptor activity	IEA
GO:0004956	Function	Prostaglandin D receptor activity	IBA
GO:0004956	Function	Prostaglandin D receptor activity	IDA	11208866
GO:0004956	Function	Prostaglandin D receptor activity	IEA
GO:0004958	Function	Prostaglandin F receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	20959461
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9973380, 10036181
GO:0006935	Process	Chemotaxis	IDA	11208866
GO:0006935	Process	Chemotaxis	IEA
GO:0006955	Process	Immune response	TAS	9973380
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11208866
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9973380
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	11208866
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:0071799	Process	Cellular response to prostaglandin D stimulus	TAS	20959461
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

Other IDs

• MIM: 604837
• HGNC: 4502
• e!Ensembl: ENSG00000183134

Protein

• UniProt ID: Q9Y5Y4
• Protein name: Prostaglandin D2 receptor 2 (Chemoattractant receptor-homologous molecule expressed on Th2 cells) (G-protein coupled receptor 44) (CD antigen CD294)
• Protein function: Receptor for prostaglandin D2 (PGD2). Coupled to the G(i)-protein. Receptor activation may result in pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also implicated in mediating PTGDR2 effects. PGD2
• PDB: 6D26, 6D27, 7M8W, 8XXU, 8XXV, 9IYB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	49 → 304	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widespread expression. High expression in stomach, small intestine, heart and thymus. Intermediate expression in colon, spinal cord and peripheral blood and low expression in brain, skeletal muscle and spleen. Expressed also on Th2- an
• Sequence:

  MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
  MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
  LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
  MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
  PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
  PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
  EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS

• Sequence length: 395

Pathways

Reactome:

Prostanoid ligand receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Allergic Fungal Sinusitis	Associate	23063330	★☆☆☆☆ Found in Text Mining only
Alopecia	Associate	29439547	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	19010788, 23506843, 25312757, 37231900	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Associate	21564420	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Inhibit	25312757	★☆☆☆☆ Found in Text Mining only
Churg Strauss Syndrome	Associate	20669282	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	31781593	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32941618	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Stimulate	11069080	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	16354184, 16782037, 39278361	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Associate	30760581	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Stimulate	21921589	★☆☆☆☆ Found in Text Mining only
Eosinophilic pustular folliculitis	Associate	20107720, 23582181	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Associate	29848886	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Associate	28615072	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Stimulate	27872865	★☆☆☆☆ Found in Text Mining only
HIV Infections	Stimulate	11069080	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	29848886	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Associate	30557325	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	11208866, 16782037, 19010788, 23506843, 30557325, 36466917	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Inhibit	18383361	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Stimulate	35352887	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Associate	29850876	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	23063330, 25268140	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	36466917	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	31320835	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	23168411	★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	36005179	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Inhibit	18383361	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	16782037	★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	25312757	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	24741632	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Associate	27872865	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Associate	27872865	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	33299869	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	37460564	★☆☆☆☆ Found in Text Mining only