Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11251
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin D2 receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGDR2
Synonyms (NCBI Gene) Gene synonyms aliases	CD294, CRTH2, DL1R, DP2, GPR44
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a G-protein-coupled receptor that is preferentially expressed in CD4+ effector T helper 2 (Th2) cells. This protein is a prostaglandin D2 receptor that mediates the pro-inflammatory chemotaxis of eosinophils, basophils, and Th2 lymphocyt

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT647268	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT647267	hsa-miR-520f-3p	HITS-CLIP	23824327
MIRT647266	hsa-miR-6715a-3p	HITS-CLIP	23824327
MIRT647265	hsa-miR-3183	HITS-CLIP	23824327
MIRT647264	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647263	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647262	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT647261	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT647260	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT647259	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT647258	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647257	hsa-miR-5695	HITS-CLIP	23824327
MIRT647256	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647255	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647254	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT647253	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647252	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT647251	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT647250	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT647249	hsa-miR-6715b-3p	HITS-CLIP	23824327
MIRT647248	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647247	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647246	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647245	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT647244	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT647243	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT647242	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT647241	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647240	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT647239	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT647268	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT647267	hsa-miR-520f-3p	HITS-CLIP	23824327
MIRT647266	hsa-miR-6715a-3p	HITS-CLIP	23824327
MIRT647265	hsa-miR-3183	HITS-CLIP	23824327
MIRT647264	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647263	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647262	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT647261	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT647260	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT647259	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT647258	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT647257	hsa-miR-5695	HITS-CLIP	23824327
MIRT647256	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647255	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647254	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT647253	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647252	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT647251	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT647250	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT647249	hsa-miR-6715b-3p	HITS-CLIP	23824327
MIRT647248	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647247	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647246	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647245	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT647244	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT647243	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT647242	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT647241	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT647240	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT647239	hsa-miR-1238-3p	HITS-CLIP	23824327

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TBX21	Repression	14500650

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001785	Function	Prostaglandin J receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IDA	11208866
GO:0004956	Function	Prostaglandin D receptor activity	IBA	21873635
GO:0004956	Function	Prostaglandin D receptor activity	IDA	11208866
GO:0004958	Function	Prostaglandin F receptor activity	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006935	Process	Chemotaxis	IDA	11208866
GO:0006955	Process	Immune response	TAS	9973380
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11208866
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0019722	Process	Calcium-mediated signaling	IDA	11208866
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042923	Function	Neuropeptide binding	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

MIM	HGNC	e!Ensembl
604837	4502	ENSG00000183134

Protein

UniProt ID

Q9Y5Y4

Protein name

Prostaglandin D2 receptor 2 (Chemoattractant receptor-homologous molecule expressed on Th2 cells) (G-protein coupled receptor 44) (CD antigen CD294)

Protein function

Receptor for prostaglandin D2 (PGD2). Coupled to the G(i)-protein. Receptor activation may result in pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also implicated in mediating PTGDR2 effects. PGD2

PDB

6D26 , 6D27 , 7M8W , 8XXU , 8XXV , 9IYB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	49 → 304	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widespread expression. High expression in stomach, small intestine, heart and thymus. Intermediate expression in colon, spinal cord and peripheral blood and low expression in brain, skeletal muscle and spleen. Expressed also on Th2- an

Sequence

MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS

Sequence length

395

Interactions

View interactions

	Reactome
			Prostanoid ligand receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma, Asthma, Aspirin-Induced		27103662, 20485159	ClinVar

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Allergic Fungal Sinusitis	Associate	23063330
Alopecia	Associate	29439547
Asthma	Associate	19010788, 23506843, 25312757, 37231900
Carcinoma Hepatocellular	Associate	21564420
Carcinoma Squamous Cell	Inhibit	25312757
Churg Strauss Syndrome	Associate	20669282
Colorectal Neoplasms	Associate	31781593
COVID 19	Associate	32941618
Dermatitis Atopic	Stimulate	11069080
Dermatitis Atopic	Associate	16354184, 16782037, 39278361
Eosinophilia	Associate	30760581
Eosinophilic Esophagitis	Stimulate	21921589
Eosinophilic pustular folliculitis	Associate	20107720, 23582181
Gaucher Disease	Associate	29848886
Granulomatosis with Polyangiitis	Associate	28615072
Hashimoto Disease	Stimulate	27872865
HIV Infections	Stimulate	11069080
Huntington Disease	Associate	29848886
Hyperglycemia	Associate	30557325
Inflammation	Associate	11208866, 16782037, 19010788, 23506843, 30557325, 36466917
Lung Diseases Interstitial	Inhibit	18383361
Macular Degeneration	Stimulate	35352887
Multiple System Atrophy	Associate	29850876
Nasal Polyps	Associate	23063330, 25268140
Nasal Polyps	Stimulate	36466917
Pulmonary Disease Chronic Obstructive	Stimulate	31320835
Rhinitis Allergic	Associate	23168411
Sarcoma	Associate	36005179
Scleroderma Systemic	Inhibit	18383361
Skin Diseases	Associate	16782037
Status Asthmaticus	Associate	25312757
Stomach Neoplasms	Stimulate	24741632
Thyroid Nodule	Associate	27872865
Thyroiditis	Associate	27872865
Triple Negative Breast Neoplasms	Associate	33299869
Tuberculosis	Associate	37460564

PTGDR2 (prostaglandin D2 receptor 2)