KLK8 (kallikrein related peptidase 8)

Gene

• Entrez ID: 11202
• Gene name: Kallikrein related peptidase 8
• Gene symbol: KLK8
• Synonyms (NCBI Gene): HNP, NP, NRPN, PRSS19, TADG14
• Chromosome: 19
• Chromosome location: 19q13.41
• Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16337200
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	17761692, 19194479, 24705354, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IDA	17761692
GO:0005737	Component	Cytoplasm	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009611	Process	Response to wounding	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0043616	Process	Keratinocyte proliferation	ISS
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0050807	Process	Regulation of synapse organization	ISS
GO:0050808	Process	Synapse organization	IEA
GO:0051604	Process	Protein maturation	IBA
GO:0097180	Component	Serine protease inhibitor complex	IDA	17761692

Other IDs

• MIM: 605644
• HGNC: 6369
• e!Ensembl: ENSG00000129455

Protein

• UniProt ID: O60259
• Protein name: Kallikrein-8 (hK8) (EC 3.4.21.118) (Neuropsin) (NP) (Ovasin) (Serine protease 19) (Serine protease TADG-14) (Tumor-associated differentially expressed gene 14 protein)
• Protein function: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation
• PDB: 5MS3, 5MS4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	33 → 252	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and
• Sequence:

  MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGG
  VLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHD
  LMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFP
  QKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPG
  VYTNICRYLDWIKKIIGSKG

• Sequence length: 260

Pathways

Reactome:

Formation of the cornified envelope