Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11201
Gene name Gene Name - the full gene name approved by the HGNC.
DNA polymerase iota
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POLI
Synonyms (NCBI Gene) Gene synonyms aliases
RAD30B, RAD3OB, eta2
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides acr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049053 hsa-miR-92a-3p CLASH 23622248
MIRT497086 hsa-miR-455-5p PAR-CLIP 22291592
MIRT450749 hsa-miR-4786-5p PAR-CLIP 22291592
MIRT450750 hsa-miR-769-5p PAR-CLIP 22291592
MIRT450748 hsa-miR-548aj-5p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003684 Function Damaged DNA binding IEA
GO:0003887 Function DNA-directed DNA polymerase activity IBA 21873635
GO:0003887 Function DNA-directed DNA polymerase activity TAS
GO:0005515 Function Protein binding IPI 16189514, 16763556, 18923427, 19060904, 21516116, 25416956, 30659753, 32296183, 32814053
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605252 9182 ENSG00000101751
Protein
UniProt ID Q9UNA4
Protein name DNA polymerase iota (EC 2.7.7.7) (Eta2) (RAD30 homolog B)
Protein function Error-prone DNA polymerase specifically involved in DNA repair (PubMed:11013228, PubMed:11387224). Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls (PubMed:1
PDB 1T3N , 1ZET , 2ALZ , 2DPI , 2DPJ , 2FLL , 2FLN , 2FLP , 2KHU , 2KHW , 2KTF , 2L0F , 2L0G , 2MBB , 3EPG , 3EPI , 3G6V , 3G6X , 3G6Y , 3GV5 , 3GV7 , 3GV8 , 3H40 , 3H4B , 3H4D , 3NGD , 3OSN , 3Q8P , 3Q8Q , 3Q8R , 3Q8S , 4EBC , 4EBD , 4EBE , 4EYH , 4EYI , 4FS1 , 4FS2 , 5KT2 , 5KT3 , 5KT4 , 5KT5 , 5KT6 , 5KT7 , 5ULW , 5ULX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00817 IMS 58 236 impB/mucB/samB family Family
PF11799 IMS_C 320 446 impB/mucB/samB family C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in testis. {ECO:0000269|PubMed:10458907, ECO:0000269|PubMed:11387224}.
Sequence
MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNASSRVIVHVDL
DCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVN
GEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSG
HVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSG
VFKP
NQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGI
SVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQD
GRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMV
NVKMPFHLTLLSVCFCNLKALNTAKK
GLIDYYLMPSLSTTSRSGKHSFKMKDTHMEDFPK
DKETNRDFLPSGRIESTRTRESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQ
EEILSGKSREKFQGKGSVSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPC
EPGTSGFNSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSNPAVSAFHSFP
NLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAV
QKELLAEWKRAGSDFHIGHK
Sequence length 740
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Fanconi anemia pathway   Translesion synthesis by POLI
Termination of translesion DNA synthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 23143594, 25903422, 25574825
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma, Childhood asthma 30929738 ClinVar, GWAS
Eczema Eczema GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37079368
Breast Neoplasms Associate 27485818, 30829610
Carcinogenesis Associate 36526675
Clear cell metastatic renal cell carcinoma Associate 39237917
Developmental Disabilities Associate 34887565
Esophageal Neoplasms Associate 22509890, 26097541
Esophageal Squamous Cell Carcinoma Associate 22509890, 28905458
Fanconi Anemia Associate 33376220
Glioblastoma Associate 17499043
Leiomyosarcoma Associate 35201535