WBP4 (WW domain binding protein 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 11193
Gene name WW domain binding protein 4
Gene symbol WBP4
Synonyms (NCBI Gene)
FBP21NEDHFDB
Chromosome 13
Chromosome location 13q14.11
Summary This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron
miRNA miRNA information provided by mirtarbase database.
349
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (349)
miRTarBase ID miRNA Experiments Reference
MIRT050577 hsa-miR-20a-5p CLASH 23622248
MIRT405627 hsa-miR-19b-3p PAR-CLIP 20371350
MIRT405626 hsa-miR-19a-3p PAR-CLIP 20371350
MIRT405636 hsa-miR-548n PAR-CLIP 20371350
MIRT405630 hsa-miR-548a-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 28781166
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IBA
GO:0005515 Function Protein binding IPI 17500595, 28838205, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604981 12739 ENSG00000120688
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75554
Protein name WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4)
Protein function Involved in pre-mRNA splicing as a component of the spliceosome (PubMed:19592703, PubMed:28781166, PubMed:9724750). May play a role in cross-intron bridging of U1 and U2 snRNPs in the mammalian A complex (PubMed:9724750). {ECO:0000269|PubMed:195
PDB 2DK1 , 2JXW , 5O9Z , 6AHD , 7OS1 , 8H6K , 8H6L , 8Q7N , 8QO9 , 8QPE , 8QZS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06220 zf-U1 8 → 44 U1 zinc finger Domain
PF00397 WW 124 → 153 WW domain Domain
PF00397 WW 165 → 194 WW domain Domain
Sequence 
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ
Sequence length 376
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    mRNA Splicing - Major Pathway
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder Likely pathogenic; Pathogenic rs2541856897, rs2541859093, rs1427720732, rs1355288041 RCV003334354
RCV003334356
RCV003334357
RCV003334358
Neurodevelopmental disorder with hypotonia, feeding difficulties, facial dysmorphism, and brain abnormalities Likely pathogenic; Pathogenic rs2541856897 RCV004577573
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Developmental Disabilities Associate 37963460
Intellectual Disability Associate 37963460