Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11187
Gene name Gene Name - the full gene name approved by the HGNC.	Plakophilin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PKP3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments
MIRT1238145	hsa-miR-1470	CLIP-seq
MIRT1238146	hsa-miR-1913	CLIP-seq
MIRT1238147	hsa-miR-2355-5p	CLIP-seq
MIRT1238148	hsa-miR-296-5p	CLIP-seq
MIRT1238149	hsa-miR-3136-3p	CLIP-seq
MIRT1238150	hsa-miR-3184	CLIP-seq
MIRT1238151	hsa-miR-324-3p	CLIP-seq
MIRT1238152	hsa-miR-3667-5p	CLIP-seq
MIRT1238153	hsa-miR-3691-3p	CLIP-seq
MIRT1238154	hsa-miR-423-5p	CLIP-seq
MIRT1238155	hsa-miR-4456	CLIP-seq
MIRT1238156	hsa-miR-4480	CLIP-seq
MIRT1238157	hsa-miR-4667-3p	CLIP-seq
MIRT1238158	hsa-miR-4725-5p	CLIP-seq
MIRT1238159	hsa-miR-4749-3p	CLIP-seq
MIRT1238160	hsa-miR-4786-3p	CLIP-seq
MIRT1238161	hsa-miR-504	CLIP-seq
MIRT1238162	hsa-miR-663b	CLIP-seq
MIRT2070105	hsa-miR-1225-3p	CLIP-seq
MIRT2070106	hsa-miR-1233	CLIP-seq
MIRT2070107	hsa-miR-134	CLIP-seq
MIRT2070108	hsa-miR-1825	CLIP-seq
MIRT2070109	hsa-miR-197	CLIP-seq
MIRT2070110	hsa-miR-1972	CLIP-seq
MIRT2070111	hsa-miR-2278	CLIP-seq
MIRT2070112	hsa-miR-3118	CLIP-seq
MIRT2070113	hsa-miR-3164	CLIP-seq
MIRT2070114	hsa-miR-4501	CLIP-seq
MIRT2070115	hsa-miR-4717-5p	CLIP-seq
MIRT2070116	hsa-miR-4755-3p	CLIP-seq
MIRT2070117	hsa-miR-512-3p	CLIP-seq
MIRT2070110	hsa-miR-1972	CLIP-seq
MIRT1238147	hsa-miR-2355-5p	CLIP-seq
MIRT1238153	hsa-miR-3691-3p	CLIP-seq
MIRT1238156	hsa-miR-4480	CLIP-seq
MIRT2070115	hsa-miR-4717-5p	CLIP-seq
MIRT2070116	hsa-miR-4755-3p	CLIP-seq
MIRT1238160	hsa-miR-4786-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ZEB1	Repression	17391671

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	TAS
GO:0002159	Process	Desmosome assembly	IMP	20859650
GO:0003723	Function	RNA binding	IDA	25225333
GO:0005515	Function	Protein binding	IPI	25225333, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	20859650
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	TAS	10374265
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0005912	Component	Adherens junction	IBA	21873635
GO:0006417	Process	Regulation of translation	IMP	25225333
GO:0007043	Process	Cell-cell junction assembly	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IMP	25225333
GO:0019899	Function	Enzyme binding	IPI	25225333
GO:0030054	Component	Cell junction	IDA
GO:0030057	Component	Desmosome	IEA
GO:0031424	Process	Keratinization	TAS
GO:0045182	Function	Translation regulator activity	IMP	25225333
GO:0045294	Function	Alpha-catenin binding	IPI	23136403
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0050839	Function	Cell adhesion molecule binding	IPI	20859650
GO:0070268	Process	Cornification	TAS
GO:0072659	Process	Protein localization to plasma membrane	IMP	20859650
GO:0098609	Process	Cell-cell adhesion	IBA	21873635
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:1902373	Process	Negative regulation of mRNA catabolic process	IMP	25225333
GO:1990124	Component	Messenger ribonucleoprotein complex	IDA	25225333

MIM	HGNC	e!Ensembl
605561	9025	ENSG00000184363

Protein

UniProt ID

Q9Y446

Protein name

Plakophilin-3

Protein function

A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (PubMed:24124604). Required for the localization of DSG2, DSP and PKP2 to mature desmosome junctions (PubMed:20859650). May also play a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00514	Arm	350 → 390	Armadillo/beta-catenin-like repeat	Repeat
PF00514	Arm	392 → 432	Armadillo/beta-catenin-like repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in the epidermis of the skin, in squamous non-cornifying epithelial cells in the vagina, single layer epithelia of the duodenum and pancreas acini and non-epithelial dendritic reticulum cells of lymph node follicles (at prote

Sequence

MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQ
PRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWS
SRSAVDLSCSRRLSSAHNGGSAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLS
LRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPS
RTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGF
NSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSL
QAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATG
FLRNLSSASQATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYD
EMPPSALQRLEGRGRRDLAGAPPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLE
WLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWAGVLSRLALEQERILNPL
LDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKSPPAEVLVN
IIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSLLANLWQYNKL
HRDFRAKGYRKEDFLGP

Sequence length

797

Interactions

View interactions

	Reactome
			Keratinization Formation of the cornified envelope

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenomyosis	Associate	37019419
Autoimmune Diseases	Associate	24328683
Calcinosis Cutis	Associate	20501752
Carcinogenesis	Associate	29377892, 34733461
Carcinoma Non Small Cell Lung	Associate	38200443
Cystic Fibrosis	Associate	34415821
Death	Associate	20501752, 26872154
Gastrointestinal Neoplasms	Associate	18801625, 20501752
HIV Infections	Associate	26872154
Inflammation	Associate	34415821
Lung Neoplasms	Associate	34415821
Lymphatic Metastasis	Associate	30855445
Melanoma	Associate	29377892, 37924160
Neoplasm Metastasis	Associate	20501752, 34455760
Neoplasms	Associate	18801625, 20501752, 29377892, 34455760, 34733461
Neoplasms	Stimulate	20348237
Ovarian Neoplasms	Associate	30855445, 34733461
Pancreatic Neoplasms	Associate	34321959
Pemphigus	Associate	19756386, 24328683
Precancerous Conditions	Associate	34733461
Prostatic Neoplasms	Associate	20348237, 35075375
Sarcoma	Associate	28088687
Stomach Neoplasms	Associate	21194493
Tuberculosis	Associate	22223854, 26872154
Tuberculosis Meningeal	Associate	22223854, 26872154
Tuberculosis Pulmonary	Associate	22223854

PKP3 (plakophilin 3)