Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11187
Gene name Gene Name - the full gene name approved by the HGNC.	Plakophilin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PKP3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments
MIRT1238145	hsa-miR-1470	CLIP-seq
MIRT1238146	hsa-miR-1913	CLIP-seq
MIRT1238147	hsa-miR-2355-5p	CLIP-seq
MIRT1238148	hsa-miR-296-5p	CLIP-seq
MIRT1238149	hsa-miR-3136-3p	CLIP-seq
MIRT1238150	hsa-miR-3184	CLIP-seq
MIRT1238151	hsa-miR-324-3p	CLIP-seq
MIRT1238152	hsa-miR-3667-5p	CLIP-seq
MIRT1238153	hsa-miR-3691-3p	CLIP-seq
MIRT1238154	hsa-miR-423-5p	CLIP-seq
MIRT1238155	hsa-miR-4456	CLIP-seq
MIRT1238156	hsa-miR-4480	CLIP-seq
MIRT1238157	hsa-miR-4667-3p	CLIP-seq
MIRT1238158	hsa-miR-4725-5p	CLIP-seq
MIRT1238159	hsa-miR-4749-3p	CLIP-seq
MIRT1238160	hsa-miR-4786-3p	CLIP-seq
MIRT1238161	hsa-miR-504	CLIP-seq
MIRT1238162	hsa-miR-663b	CLIP-seq
MIRT2070105	hsa-miR-1225-3p	CLIP-seq
MIRT2070106	hsa-miR-1233	CLIP-seq
MIRT2070107	hsa-miR-134	CLIP-seq
MIRT2070108	hsa-miR-1825	CLIP-seq
MIRT2070109	hsa-miR-197	CLIP-seq
MIRT2070110	hsa-miR-1972	CLIP-seq
MIRT2070111	hsa-miR-2278	CLIP-seq
MIRT2070112	hsa-miR-3118	CLIP-seq
MIRT2070113	hsa-miR-3164	CLIP-seq
MIRT2070114	hsa-miR-4501	CLIP-seq
MIRT2070115	hsa-miR-4717-5p	CLIP-seq
MIRT2070116	hsa-miR-4755-3p	CLIP-seq
MIRT2070117	hsa-miR-512-3p	CLIP-seq
MIRT2070110	hsa-miR-1972	CLIP-seq
MIRT1238147	hsa-miR-2355-5p	CLIP-seq
MIRT1238153	hsa-miR-3691-3p	CLIP-seq
MIRT1238156	hsa-miR-4480	CLIP-seq
MIRT2070115	hsa-miR-4717-5p	CLIP-seq
MIRT2070116	hsa-miR-4755-3p	CLIP-seq
MIRT1238160	hsa-miR-4786-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ZEB1	Repression	17391671

Show/Hide all(62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0001533	Component	Cornified envelope	IEA
GO:0001533	Component	Cornified envelope	TAS
GO:0002159	Process	Desmosome assembly	IEA
GO:0002159	Process	Desmosome assembly	IMP	20859650
GO:0002159	Process	Desmosome assembly	ISS
GO:0002718	Process	Regulation of cytokine production involved in immune response	IEA
GO:0002718	Process	Regulation of cytokine production involved in immune response	ISS
GO:0002934	Process	Desmosome organization	IEA
GO:0002934	Process	Desmosome organization	ISS
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24124604, 25225333, 29678907, 32296183, 32814053, 34058472
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24124604, 34058472
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24124604, 25501895, 34058472
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25501895, 30949721
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	TAS	10374265
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IEA
GO:0006417	Process	Regulation of translation	IMP	25225333
GO:0007155	Process	Cell adhesion	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010669	Process	Epithelial structure maintenance	IEA
GO:0010669	Process	Epithelial structure maintenance	ISS
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	25225333
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IMP	29678907
GO:0022409	Process	Positive regulation of cell-cell adhesion	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030054	Component	Cell junction	IDA
GO:0030057	Component	Desmosome	IDA	20613778, 20859650, 24124604, 25501895
GO:0030057	Component	Desmosome	IEA
GO:0030057	Component	Desmosome	ISS
GO:0045294	Function	Alpha-catenin binding	IPI	23136403
GO:0045296	Function	Cadherin binding	IBA
GO:0045785	Process	Positive regulation of cell adhesion	IMP	24124604
GO:0050839	Function	Cell adhesion molecule binding	IPI	20859650
GO:0051797	Process	Regulation of hair follicle development	IEA
GO:0051797	Process	Regulation of hair follicle development	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0072659	Process	Protein localization to plasma membrane	IMP	20859650
GO:0090136	Process	Epithelial cell-cell adhesion	IEA
GO:0090136	Process	Epithelial cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:1902373	Process	Negative regulation of mRNA catabolic process	IMP	25225333
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	IEA
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	ISS
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:1903829	Process	Positive regulation of protein localization	ISS

MIM	HGNC	e!Ensembl
605561	9025	ENSG00000184363

Protein

UniProt ID

Q9Y446

Protein name

Plakophilin-3

Protein function

A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (PubMed:24124604). Required for the localization of DSG2, DSP and PKP2 to mature desmosome junctions (PubMed:20859650). May also play a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00514	Arm	350 → 390	Armadillo/beta-catenin-like repeat	Repeat
PF00514	Arm	392 → 432	Armadillo/beta-catenin-like repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in the epidermis of the skin, in squamous non-cornifying epithelial cells in the vagina, single layer epithelia of the duodenum and pancreas acini and non-epithelial dendritic reticulum cells of lymph node follicles (at prote

Sequence

MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQ
PRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWS
SRSAVDLSCSRRLSSAHNGGSAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLS
LRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPS
RTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGF
NSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSL
QAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATG
FLRNLSSASQATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYD
EMPPSALQRLEGRGRRDLAGAPPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLE
WLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWAGVLSRLALEQERILNPL
LDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKSPPAEVLVN
IIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSLLANLWQYNKL
HRDFRAKGYRKEDFLGP

Sequence length

797

Interactions

View interactions

	Reactome
			Keratinization Formation of the cornified envelope

PKP3 (plakophilin 3)