Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11178
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine zipper tumor suppressor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LZTS1
Synonyms (NCBI Gene) Gene synonyms aliases
F37, FEZ1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28937897 A>G Pathogenic Coding sequence variant, missense variant
rs119473032 T>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT437778 hsa-miR-135b-5p 5.0 23695671
MIRT437778 hsa-miR-135b-5p 5.0 23695671
MIRT438741 hsa-miR-214-3p 5.0 24802407
MIRT438741 hsa-miR-214-3p 5.0 24802407
MIRT438741 hsa-miR-214-3p 5.0 24802407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17349584, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0008017 Function Microtubule binding IEA
GO:0014069 Component Postsynaptic density IEA
GO:0016242 Process Negative regulation of macroautophagy IMP
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606551 13861 ENSG00000061337
Protein
UniProt ID Q9Y250
Protein name Leucine zipper putative tumor suppressor 1 (F37/esophageal cancer-related gene-coding leucine-zipper motif) (Fez1)
Protein function Involved in the regulation of cell growth. May stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. May act as a tumor suppressor. {ECO:0000
PDB 8Y1U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06818 Fez1 380 565 Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis, prostate, spleen, thymus, ovary and brain. Detected at lower levels in heart, placenta, small intestine, colon, liver, kidney, skeletal muscle and pancreas. Not detectable in primary tumors from breast and p
Sequence
MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMG
KSEDFFYIKVSQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKG
AVRPTAFKPVLPRSGAILHSSPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMS
SLPTHSTSSSYQLDPLVTPVGPTSRFGGSAHNITQGIVLQDSNMMSLKALSFSDGGSKLG
HSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKLQRSFEEKELASSLAYEERPR
RCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELESLMKEQDLLE
TKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRA
QAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVI
QYQKQLQQSYVAMYQRNQRLEKALQ
QLARGDSAGEPLEVDLEGADIPYEDIIATEI
Sequence length 596
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259
Esophageal carcinoma Esophageal carcinoma, Carcinoma in situ of esophagus rs121912967
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 12377406
Unknown
Disease term Disease name Evidence References Source
Dental caries Dental caries GWAS
Preeclampsia Preeclampsia GWAS
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 11504921, 25813822
Breast Neoplasms Inhibit 18686028
Carcinoma Hepatocellular Associate 32311840
Carcinoma Squamous Cell Associate 25938461
Ehlers Danlos syndrome type 3 Associate 26504261
Joint Instability Associate 26504261
Kidney Neoplasms Associate 15357873
Lung Neoplasms Associate 15735004
Lymphatic Metastasis Associate 18686028
Lymphatic Metastasis Inhibit 25813822