Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11167
Gene name Gene Name - the full gene name approved by the HGNC.
Follistatin like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FSTL1
Synonyms (NCBI Gene) Gene synonyms aliases
FRP, FSL1, MIR198, OCC-1, OCC1, tsc36
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheu
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020891 hsa-miR-155-5p Proteomics 18668040
MIRT001789 hsa-miR-206 Reporter assay 17030984
MIRT022846 hsa-miR-124-3p Microarray 18668037
MIRT029771 hsa-miR-26b-5p Microarray 19088304
MIRT051922 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 19060904, 20860622, 22265692, 25416956, 32296183, 32814053
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space HDA 16502470
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605547 3972 ENSG00000163430
Protein
UniProt ID Q12841
Protein name Follistatin-related protein 1 (Follistatin-like protein 1)
Protein function Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation (PubMed:22265692, PubMed:29212066). Plays a role in the development of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 31 52 Follistatin/Osteonectin-like EGF domain Domain
PF07648 Kazal_2 53 98 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in synovial tissues from rheumatoid arthritis (PubMed:15638044). {ECO:0000269|PubMed:15638044}.
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHC
KEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Signaling by BMP
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
17849003
Unknown
Disease term Disease name Evidence References Source
Drusen Drusen GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acne Vulgaris Stimulate 39493760
Aortic Valve Disease Associate 30722102
Arteriovenous Malformations Associate 36012380
Arthritis Associate 21303509, 22117761
Arthritis Juvenile Stimulate 23678162
Arthritis Rheumatoid Stimulate 21303509
Arthritis Rheumatoid Associate 26716515, 27498552, 35572839
Asthma Associate 28845090, 33825599
Atrioventricular Septal Defect Associate 30722102
Autoimmune Diseases of the Nervous System Associate 21303509