Gene Gene information from NCBI Gene database.
Entrez ID 11167
Gene name Follistatin like 1
Gene symbol FSTL1
Synonyms (NCBI Gene)
FRPFSL1MIR198OCC-1OCC1tsc36
Chromosome 3
Chromosome location 3q13.33
Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheu
miRNA miRNA information provided by mirtarbase database.
1271
miRTarBase ID miRNA Experiments Reference
MIRT020891 hsa-miR-155-5p Proteomics 18668040
MIRT001789 hsa-miR-206 Reporter assay 17030984
MIRT022846 hsa-miR-124-3p Microarray 18668037
MIRT029771 hsa-miR-26b-5p Microarray 19088304
MIRT051922 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 19060904, 20860622, 22265692, 25416956, 32296183, 32814053
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605547 3972 ENSG00000163430
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12841
Protein name Follistatin-related protein 1 (Follistatin-like protein 1)
Protein function Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation (PubMed:22265692, PubMed:29212066). Plays a role in the development of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 31 52 Follistatin/Osteonectin-like EGF domain Domain
PF07648 Kazal_2 53 98 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in synovial tissues from rheumatoid arthritis (PubMed:15638044). {ECO:0000269|PubMed:15638044}.
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHC
KEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Signaling by BMP
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation