Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11156
Gene name Gene Name - the full gene name approved by the HGNC.	Protein tyrosine phosphatase 4A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTP4A3
Synonyms (NCBI Gene) Gene synonyms aliases	PRL-3, PRL-R, PRL3
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004166	hsa-miR-192-5p	Microarray	16822819
MIRT053486	hsa-miR-495-3p	qRT-PCR, Western blot	22469786
MIRT053487	hsa-miR-551a	qRT-PCR, Western blot	22469786
MIRT1274136	hsa-miR-1915	CLIP-seq
MIRT1274137	hsa-miR-3184	CLIP-seq
MIRT1274138	hsa-miR-3917	CLIP-seq
MIRT1274139	hsa-miR-3918	CLIP-seq
MIRT1274140	hsa-miR-423-5p	CLIP-seq
MIRT1274141	hsa-miR-4268	CLIP-seq
MIRT1274142	hsa-miR-4283	CLIP-seq
MIRT1274143	hsa-miR-4685-5p	CLIP-seq
MIRT1274144	hsa-miR-4717-5p	CLIP-seq
MIRT1274145	hsa-miR-4731-3p	CLIP-seq
MIRT1274146	hsa-miR-4768-3p	CLIP-seq
MIRT1274147	hsa-miR-4801	CLIP-seq
MIRT1274148	hsa-miR-138	CLIP-seq
MIRT1274149	hsa-miR-3064-5p	CLIP-seq
MIRT1274150	hsa-miR-3150b-3p	CLIP-seq
MIRT1274151	hsa-miR-3650	CLIP-seq
MIRT1274152	hsa-miR-3652	CLIP-seq
MIRT1274153	hsa-miR-3689d	CLIP-seq
MIRT1274154	hsa-miR-4430	CLIP-seq
MIRT1274155	hsa-miR-4484	CLIP-seq
MIRT1274156	hsa-miR-4505	CLIP-seq
MIRT1274157	hsa-miR-4784	CLIP-seq
MIRT1274158	hsa-miR-4786-5p	CLIP-seq
MIRT1274159	hsa-miR-542-5p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS	9514946
GO:0005515	Function	Protein binding	IPI	23178297
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IMP	23178297
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IMP	23178297
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	23178297
GO:0007219	Process	Notch signaling pathway	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043542	Process	Endothelial cell migration	IBA
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	IMP	24403062
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	23178297
GO:1904951	Process	Positive regulation of establishment of protein localization	IMP	23178297
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
606449	9636	ENSG00000184489

Protein

UniProt ID

O75365

Protein name

Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL-R) (Protein-tyrosine phosphatase 4a3) (Protein-tyrosine phosphatase of regenerating liver 3) (PRL-3)

Protein function

Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypert

PDB

1R6H , 1V3A , 2MBC , 5TSR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00782	DSPc	30 → 154	Dual specificity phosphatase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis. {ECO:0000269|PubMed:11355880}.

Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM

Sequence length

173

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Pilocytic astrocytoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma Mucinous	Associate	24696260
Attention Deficit Disorder with Hyperactivity	Associate	32238911
Bone Diseases	Associate	17934070
Breast Neoplasms	Associate	16832410, 20140626, 25547164, 25854368, 26921331, 27452906
Calcinosis Cutis	Associate	24030100
Cancer Pain	Stimulate	19586538
Carcinogenesis	Associate	18268019, 26041460
Carcinoma Adenoid Cystic	Associate	26041460
Carcinoma Hepatocellular	Associate	23064776, 30418964, 40159482
Carcinoma Intraductal Noninfiltrating	Associate	16832410
Carcinoma Non Small Cell Lung	Associate	27901069
Carcinoma Renal Cell	Associate	34630392
Cholangiocarcinoma	Associate	19757198
Clinical Deterioration	Associate	29190795
Colorectal Neoplasms	Associate	15750208, 17235563, 19846928, 19930715, 20860603, 21811102, 22677902, 31298325, 31546234, 33512811, 33907129
Colorectal Neoplasms	Stimulate	24885636, 33179291
Death	Associate	29190795
Death	Stimulate	33179291
Disease Progression	Associate	37898408
Drug Related Side Effects and Adverse Reactions	Associate	32024182
Endometrial Neoplasms	Associate	29951943, 30888986
Endometriosis	Associate	20045518
Esophageal Squamous Cell Carcinoma	Associate	18684031
Glioma	Associate	35098869
Hepatitis B	Stimulate	23064776
Laryngeal Neoplasms	Stimulate	17641416
Leukemia	Associate	32024182
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22995644
Leukemia Myeloid	Associate	31546234
Leukemia Myeloid Acute	Associate	21589872, 31546234, 36246561
Leukemia T Cell	Associate	23929599
Liver Failure	Associate	35098869
Lymphatic Metastasis	Associate	17235563, 19846928, 21466710, 21478108, 24330843, 24696260, 25854368
Lymphatic Metastasis	Stimulate	18684031, 19322925, 19757198, 20140626, 30418964
Lymphoma Non Hodgkin	Associate	21478108
Monoclonal Gammopathy of Undetermined Significance	Stimulate	17934070
Mouth Diseases	Associate	21790231
Mouth Neoplasms	Associate	21790231, 36849997
Multiple Myeloma	Associate	17934070, 20574050, 27036022, 27698077, 34092011, 34327809, 35276027
Nasal Polyps	Associate	37898408
Neoplasm Invasiveness	Associate	30418964
Neoplasm Metastasis	Associate	15135076, 17235563, 17641416, 17934070, 18268019, 19247814, 19757198, 19846928, 19930715, 20140626, 20860603, 21466710, 21589872, 22677902, 22995644 View all (12 more)
Neoplasm Metastasis	Stimulate	33179291
Neoplasms	Associate	15135076, 15750208, 16832410, 17235563, 18078820, 18268019, 19247814, 19586538, 19757198, 19846928, 20140626, 20860603, 21765462, 22073279, 23064776 View all (19 more)
Neoplasms	Stimulate	19322925
NOG Related Symphalangism Spectrum Disorder	Associate	15750208
Ovarian Neoplasms	Stimulate	19247814
Ovarian Neoplasms	Associate	34209460
Pancreatitis	Stimulate	19586538
Periodontitis	Associate	34732256
Peritonitis	Stimulate	27572739
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	23929599
Prostatic Neoplasms	Associate	26975394, 29190795, 29207031
Prostatitis	Associate	29207031
Retinal Dysplasia	Stimulate	21790231
Smoldering Multiple Myeloma	Stimulate	17934070
Squamous Cell Carcinoma of Head and Neck	Associate	21790231
Stomach Neoplasms	Associate	17235563, 19322925, 21466710, 21478108, 24330843, 24696260, 27572739
Tertiary Lymphoid Structures	Associate	19846928
Tertiary Lymphoid Structures	Stimulate	21478108, 24696260
Triple Negative Breast Neoplasms	Associate	26909599, 26921331
Uveal melanoma	Associate	30816227
Vitamin D Deficiency	Associate	15750208

PTP4A3 (protein tyrosine phosphatase 4A3)