CD160 (CD160 molecule)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11126
Gene name Gene Name - the full gene name approved by the HGNC.
CD160 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD160
Synonyms (NCBI Gene) Gene synonyms aliases
BY55, NK1, NK28
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT018975 hsa-miR-335-5p Microarray 18185580
MIRT732966 hsa-miR-1236-3p qRT-PCR 33788641
MIRT873735 hsa-miR-361-3p CLIP-seq
MIRT873736 hsa-miR-3679-3p CLIP-seq
MIRT873737 hsa-miR-3938 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002385 Process Mucosal immune response IEA
GO:0002729 Process Positive regulation of natural killer cell cytokine production IDA 17307798
GO:0002857 Process Positive regulation of natural killer cell mediated immune response to tumor cell IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604463 17013 ENSG00000117281
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95971
Protein name CD160 antigen (Natural killer cell receptor BY55) (CD antigen CD160) [Cleaved into: CD160 antigen, soluble form]
Protein function [CD160 antigen]: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pat
PDB 6NG3 , 6NG9 , 6NGG , 7MSG
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at pr
Sequence 
MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG
IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA
L
Sequence length 181
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)		 29059683
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Show/Hide Text Mining Associations (39)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 28404628
Adenocarcinoma of Lung Associate 35946526, 37014183
Arthritis Rheumatoid Associate 22449398
Atherosclerosis Associate 26071079
Autoimmune Diseases Associate 30842773, 34238277
Breast Neoplasms Associate 37996402
Colitis Ulcerative Associate 31191543
Colorectal Neoplasms Stimulate 32393998
COVID 19 Associate 38538269
Crohn Disease Associate 31191543