Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11126
Gene name Gene Name - the full gene name approved by the HGNC.	CD160 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD160
Synonyms (NCBI Gene) Gene synonyms aliases	BY55, NK1, NK28
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018975	hsa-miR-335-5p	Microarray	18185580
MIRT732966	hsa-miR-1236-3p	qRT-PCR	33788641
MIRT873735	hsa-miR-361-3p	CLIP-seq
MIRT873736	hsa-miR-3679-3p	CLIP-seq
MIRT873737	hsa-miR-3938	CLIP-seq
MIRT873738	hsa-miR-4282	CLIP-seq
MIRT2196124	hsa-miR-561	CLIP-seq
MIRT2499224	hsa-miR-3945	CLIP-seq
MIRT2499225	hsa-miR-4253	CLIP-seq
MIRT2499226	hsa-miR-4311	CLIP-seq
MIRT2499227	hsa-miR-4729	CLIP-seq
MIRT2499228	hsa-miR-539	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002385	Process	Mucosal immune response	IEA
GO:0002717	Process	Positive regulation of natural killer cell mediated immunity	IEA
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IDA	17307798
GO:0002819	Process	Regulation of adaptive immune response	IEA
GO:0002857	Process	Positive regulation of natural killer cell mediated immune response to tumor cell	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IDA	9973372
GO:0005515	Function	Protein binding	IPI	11978774, 16809620, 18193050, 25416956, 27152329, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9973372, 11978774, 18193050, 19109136
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	16809620
GO:0019900	Function	Kinase binding	IPI	11978774
GO:0023024	Function	MHC class I protein complex binding	IEA
GO:0031295	Process	T cell costimulation	IDA	9973372, 11978774
GO:0032393	Function	MHC class I receptor activity	IDA	15494480
GO:0032394	Function	MHC class Ib receptor activity	IDA	16809620
GO:0032397	Function	Activating MHC class I receptor activity	IDA	9973372, 11978774, 12486241
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IDA	19109136
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17307798
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	12486241, 17307798
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	18193050
GO:0098552	Component	Side of membrane	IEA
GO:1900280	Process	Negative regulation of CD4-positive, alpha-beta T cell costimulation	IDA	18193050
GO:1905675	Process	Negative regulation of adaptive immune memory response	IDA	18193050
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	16809620

MIM	HGNC	e!Ensembl
604463	17013	ENSG00000117281

Protein

UniProt ID

O95971

Protein name

CD160 antigen (Natural killer cell receptor BY55) (CD antigen CD160) [Cleaved into: CD160 antigen, soluble form]

Protein function

[CD160 antigen]: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pat

PDB

6NG3 , 6NG9 , 6NGG , 7MSG

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at pr

Sequence

MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG
IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA
L

Sequence length

181

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Spontaneous	Associate	28404628
Adenocarcinoma of Lung	Associate	35946526, 37014183
Arthritis Rheumatoid	Associate	22449398
Atherosclerosis	Associate	26071079
Autoimmune Diseases	Associate	30842773, 34238277
Breast Neoplasms	Associate	37996402
Colitis Ulcerative	Associate	31191543
Colorectal Neoplasms	Stimulate	32393998
COVID 19	Associate	38538269
Crohn Disease	Associate	31191543
Depressive Disorder	Associate	23064081
Down Syndrome	Associate	35222360
Drug Related Side Effects and Adverse Reactions	Stimulate	35470232
Esophageal Neoplasms	Associate	27577071
Gastrointestinal Neoplasms	Associate	33788641
Graves Disease	Associate	30842773, 34238277
HIV Infections	Associate	28335609
HIV Infections	Inhibit	36110864
Leukemia Hairy Cell	Stimulate	21715317
Leukemia Lymphocytic Chronic B Cell	Stimulate	21715317
Leukemia Lymphocytic Chronic B Cell	Associate	23247726, 24246502, 33931471
Leukemia Myeloid Acute	Inhibit	33239726
Lung Neoplasms	Associate	37014183
Lymphoma B Cell	Associate	21715317
Lymphoma Mantle Cell	Associate	21715317
Melanoma	Associate	35428910
Mood Disorders	Associate	23064081
Mycosis Fungoides	Associate	25044837
Nasopharyngeal Carcinoma	Associate	36438903
Neoplasm Residual	Associate	21715317
Neoplasms	Associate	21715317, 32393998, 34858395, 35428910, 35470232, 37014183
Neoplasms	Stimulate	37014183
Neurologic Manifestations	Associate	23064081
Pancreatic Neoplasms	Associate	32055919
Prostatic Neoplasms	Associate	36124532
Sleep Deprivation	Associate	38538269
Stomach Neoplasms	Associate	39244216
Thyroiditis Autoimmune	Associate	34238277
Urinary Bladder Neoplasms	Associate	34858395

CD160 (CD160 molecule)