KATNA1 (katanin catalytic subunit A1)

Gene

• Entrez ID: 11104
• Gene name: Katanin catalytic subunit A1
• Gene symbol: KATNA1
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002617	hsa-miR-124-3p	Microarray	18668037
MIRT002617	hsa-miR-124-3p	Microarray	15685193

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000922	Component	Spindle pole	IDA	10751153, 19261606
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	19261606, 24486153, 26496610, 26929214, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19261606, 26929214
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IDA	19261606
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0008017	Function	Microtubule binding	IDA	10751153
GO:0008017	Function	Microtubule binding	IEA
GO:0008352	Component	Katanin complex	IEA
GO:0008352	Component	Katanin complex	IPI	26929214
GO:0008568	Function	Microtubule severing ATPase activity	IBA
GO:0008568	Function	Microtubule severing ATPase activity	IDA	10751153
GO:0008568	Function	Microtubule severing ATPase activity	IEA
GO:0015630	Component	Microtubule cytoskeleton	NAS	28436967
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030496	Component	Midbody	IDA	19261606
GO:0030496	Component	Midbody	IEA
GO:0031122	Process	Cytoplasmic microtubule organization	IDA	26929214
GO:0031122	Process	Cytoplasmic microtubule organization	NAS	28436967
GO:0046982	Function	Protein heterodimerization activity	IPI	10751153
GO:0051013	Process	Microtubule severing	IBA
GO:0051013	Process	Microtubule severing	IEA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IEA
GO:0097431	Component	Mitotic spindle pole	IDA	26929214

Other IDs

• MIM: 606696
• HGNC: 6216
• e!Ensembl: ENSG00000186625

Protein

• UniProt ID: O75449
• Protein name: Katanin p60 ATPase-containing subunit A1 (Katanin p60 subunit A1) (EC 5.6.1.1) (p60 katanin)
• Protein function: Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. M
• PDB: 5ZQL, 5ZQM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00004	AAA	245 → 381	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	403 → 464	AAA+ lid domain	Domain
  PF09336	Vps4_C	439 → 489	Vps4 C terminal oligomerisation domain	Domain

• Sequence:

  MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
  VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
  SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
  KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
  PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
  SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
  FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
  ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
  YEKWIFEFGSC

• Sequence length: 491