Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11082
Gene name Gene Name - the full gene name approved by the HGNC.
Endothelial cell specific molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ESM1
Synonyms (NCBI Gene) Gene synonyms aliases
endocan
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT717078 hsa-miR-4640-3p HITS-CLIP 19536157
MIRT717077 hsa-miR-1224-3p HITS-CLIP 19536157
MIRT717076 hsa-miR-6887-3p HITS-CLIP 19536157
MIRT717075 hsa-miR-532-3p HITS-CLIP 19536157
MIRT717074 hsa-miR-942-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IBA
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEP 11866539
GO:0002040 Process Sprouting angiogenesis IMP 20616313
GO:0005171 Function Hepatocyte growth factor receptor binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601521 3466 ENSG00000164283
Protein
UniProt ID Q9NQ30
Protein name Endothelial cell-specific molecule 1 (ESM-1)
Protein function Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 28 83 Insulin-like growth factor binding protein Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
Sequence
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRC
QPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
LNPR
Sequence length 184
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lung adenocarcinoma Familial squamous cell lung carcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 31882514, 34606082
Adenoma Associate 26809958, 31455321
Albuminuria Associate 27756187
Alzheimer Disease Associate 26924874
Atherosclerosis Inhibit 23594880
Bacterial Infections Stimulate 22183069
Bone Marrow Failure Disorders Associate 22183069
Breast Carcinoma In Situ Stimulate 34151832
Breast Neoplasms Stimulate 25012244
Breast Neoplasms Associate 34151832, 37494404