ESM1 (endothelial cell specific molecule 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 11082
Gene name Endothelial cell specific molecule 1
Gene symbol ESM1
Synonyms (NCBI Gene)
endocan
Chromosome 5
Chromosome location 5q11.2
Summary This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disor
miRNA miRNA information provided by mirtarbase database.
31
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (31)
miRTarBase ID miRNA Experiments Reference
MIRT717078 hsa-miR-4640-3p HITS-CLIP 19536157
MIRT717077 hsa-miR-1224-3p HITS-CLIP 19536157
MIRT717076 hsa-miR-6887-3p HITS-CLIP 19536157
MIRT717075 hsa-miR-532-3p HITS-CLIP 19536157
MIRT717074 hsa-miR-942-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IBA
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEP 11866539
GO:0002040 Process Sprouting angiogenesis IMP 20616313
GO:0005171 Function Hepatocyte growth factor receptor binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
601521 3466 ENSG00000164283
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQ30
Protein name Endothelial cell-specific molecule 1 (ESM-1)
Protein function Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 28 → 83 Insulin-like growth factor binding protein Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
Sequence 
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
LNPR
Sequence length 184
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cholangiocarcinoma Benign rs142604597 RCV005907953
Hepatocellular carcinoma Benign rs142604597 RCV005907951
Melanoma Benign rs142604597 RCV005907952
Uterine corpus endometrial carcinoma Benign rs142604597 RCV005907954
Show/Hide Text Mining Associations (90)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 31882514, 34606082
Adenoma Associate 26809958, 31455321
Albuminuria Associate 27756187
Alzheimer Disease Associate 26924874
Atherosclerosis Inhibit 23594880
Bacterial Infections Stimulate 22183069
Bone Marrow Failure Disorders Associate 22183069
Breast Carcinoma In Situ Stimulate 34151832
Breast Neoplasms Stimulate 25012244
Breast Neoplasms Associate 34151832, 37494404