HSF2BP (heat shock transcription factor 2 binding protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 11077
Gene name Heat shock transcription factor 2 binding protein
Gene symbol HSF2BP
Synonyms (NCBI Gene)
MEILB2POF19
Chromosome 21
Chromosome location 21q22.3
Summary HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulatin
miRNA miRNA information provided by mirtarbase database.
15
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (15)
miRTarBase ID miRNA Experiments Reference
MIRT2465455 hsa-miR-3619-3p CLIP-seq
MIRT2465456 hsa-miR-4776-5p CLIP-seq
MIRT2465457 hsa-miR-4802-3p CLIP-seq
MIRT2548060 hsa-miR-1271 CLIP-seq
MIRT2548061 hsa-miR-182 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21900206, 31242413, 32296183, 33961781
GO:0005654 Component Nucleoplasm IDA
GO:0005694 Component Chromosome IDA 31242413
GO:0005694 Component Chromosome IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604554 5226 ENSG00000160207
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75031
Protein name Heat shock factor 2-binding protein
Protein function Meiotic recombination factor component of recombination bridges involved in meiotic double-strand break repair. Modulates the localization of recombinases DMC1:RAD51 to meiotic double-strand break (DSB) sites through the interaction with BRCA2 a
PDB 7BDX , 7LDG , 8A50 , 8A51
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis specific. Overexpressed in some tumors (PubMed:31242413). {ECO:0000269|PubMed:31242413, ECO:0000269|PubMed:9651507}.
Sequence 
MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIV
EKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYC
TEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDES
QFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNV
SINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSL
PLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
Sequence length 334
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Premature ovarian failure 19 Likely pathogenic rs1319345920, rs781780538 RCV001615396
RCV001615397
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35435115
Neoplasms Associate 35435115