HSF2BP (heat shock transcription factor 2 binding protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11077
Gene name Gene Name - the full gene name approved by the HGNC.
Heat shock transcription factor 2 binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HSF2BP
Synonyms (NCBI Gene) Gene synonyms aliases
MEILB2, POF19
Disease Acronyms (UniProt) Disease acronyms from UniProt database
POF19
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulatin
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
miRTarBase ID miRNA Experiments Reference
MIRT2465455 hsa-miR-3619-3p CLIP-seq
MIRT2465456 hsa-miR-4776-5p CLIP-seq
MIRT2465457 hsa-miR-4802-3p CLIP-seq
MIRT2548060 hsa-miR-1271 CLIP-seq
MIRT2548061 hsa-miR-182 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21900206, 31242413, 32296183
GO:0005694 Component Chromosome IDA 31242413
GO:0005829 Component Cytosol HDA 16780588
GO:0006366 Process Transcription by RNA polymerase II TAS 9651507
GO:0007141 Process Male meiosis I ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604554 5226 ENSG00000160207
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O75031
Protein name Heat shock factor 2-binding protein
Protein function Meiotic recombination factor component of recombination bridges involved in meiotic double-strand break repair. Modulates the localization of recombinases DMC1:RAD51 to meiotic double-strand break (DSB) sites through the interaction with BRCA2 a
PDB 7BDX , 7LDG , 8A50 , 8A51
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis specific. Overexpressed in some tumors (PubMed:31242413). {ECO:0000269|PubMed:31242413, ECO:0000269|PubMed:9651507}.
Sequence 
MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIV
EKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYC
TEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDES
QFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNV
SINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSL
PLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
Sequence length 334
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 30940143 ClinVar
Premature Ovarian Failure premature ovarian failure 19 GenCC
Eosinophilia Eosinophilia GWAS
Coronary artery disease Coronary artery disease GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35435115
Neoplasms Associate 35435115