Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11067
Gene name Gene Name - the full gene name approved by the HGNC.	DEPP autophagy regulator 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DEPP1
Synonyms (NCBI Gene) Gene synonyms aliases	C10orf10, DEPP, FIG, Fseg
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the e

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IDA	25261981
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	25261981
GO:0005739	Component	Mitochondrion	IEA
GO:0005777	Component	Peroxisome	IDA	25261981
GO:0005777	Component	Peroxisome	IEA
GO:0006914	Process	Autophagy	IEA
GO:0010506	Process	Regulation of autophagy	IBA
GO:0010506	Process	Regulation of autophagy	IDA	28545464

MIM	HGNC	e!Ensembl
611309	23355	ENSG00000165507

Protein

UniProt ID

Q9NTK1

Protein name

Protein DEPP1 (Decidual protein induced by progesterone) (Fasting-induced gene protein) (FIG)

Protein function

Acts as a critical modulator of FOXO3-induced autophagy via increased cellular ROS.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15343	DEPP	25 → 212	Decidual protein induced by progesterone family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. {ECO:0000269|PubMed:16123073}.

Sequence

MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQ
GQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQR
DLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTF
GQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL

Sequence length

212

Interactions

View interactions

	KEGG
	FoxO signaling pathway

DEPP1 (DEPP autophagy regulator 1)