Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	11065
Gene name	Ubiquitin conjugating enzyme E2 C
Gene symbol	UBE2C
Synonyms (NCBI Gene)	UBCH10dJ447F3.2
Chromosome	20
Chromosome location	20q13.12
Summary	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating e

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016310	hsa-miR-193b-3p	Microarray	20304954
MIRT021680	hsa-miR-140-3p	Sequencing	20371350
MIRT030369	hsa-miR-24-3p	Microarray	19748357
MIRT031394	hsa-miR-16-5p	Proteomics	18668040
MIRT050874	hsa-miR-17-5p	CLASH	23622248
MIRT050549	hsa-miR-20a-5p	CLASH	23622248
MIRT048197	hsa-miR-196a-5p	CLASH	23622248
MIRT040327	hsa-miR-615-3p	CLASH	23622248
MIRT039262	hsa-miR-671-5p	CLASH	23622248
MIRT050874	hsa-miR-17-5p	Luciferase reporter assayqRT-PCRWestern blot	25760688
MIRT050874	hsa-miR-17-5p	Luciferase reporter assayqRT-PCRWestern blot	25760688
MIRT050549	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	25760688
MIRT050549	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	25760688
MIRT736651	hsa-miR-381-3p	Luciferase reporter assayWestern blottingqRT-PCR	31646760
MIRT756334	hsa-miR-4429	Luciferase reporter assayWestern blottingqRT-PCR	35866591
MIRT1467069	hsa-miR-300	CLIP-seq
MIRT1467070	hsa-miR-3188	CLIP-seq
MIRT1467071	hsa-miR-381	CLIP-seq
MIRT1467072	hsa-miR-4437	CLIP-seq
MIRT1467073	hsa-miR-4666-3p	CLIP-seq
MIRT1467074	hsa-miR-4729	CLIP-seq
MIRT1467075	hsa-miR-4775	CLIP-seq
MIRT1467076	hsa-miR-624	CLIP-seq
MIRT1467077	hsa-miR-889	CLIP-seq
MIRT2361098	hsa-miR-1276	CLIP-seq
MIRT2361099	hsa-miR-1284	CLIP-seq
MIRT2361100	hsa-miR-337-3p	CLIP-seq
MIRT2361101	hsa-miR-4311	CLIP-seq
MIRT2361102	hsa-miR-4719	CLIP-seq
MIRT2361103	hsa-miR-577	CLIP-seq
MIRT2361104	hsa-miR-583	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
MED1	Unknown	21556051
MYC	Activation	22170434

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	15749827
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18485873, 19820702, 19822757
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0005515	Function	Protein binding	IPI	19822757, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IDA	16413484, 18485873, 19822757
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9122200, 18485873
GO:0010458	Process	Exit from mitosis	IMP	19822757
GO:0010994	Process	Free ubiquitin chain polymerization	IDA	19822757
GO:0016567	Process	Protein ubiquitination	IDA	9122200
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019787	Function	Ubiquitin-like protein transferase activity	IEA
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	9122200, 19822757
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	22017875, 22017876, 22017877
GO:0031536	Process	Positive regulation of exit from mitosis	IMP	9122200
GO:0032446	Process	Protein modification by small protein conjugation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	27910872
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	27910872
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	15749827
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	9637688
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	12629039
GO:0051301	Process	Cell division	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	12629039, 27910872
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 19822757, 20061386, 27910872
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	TAS	17443180

MIM	HGNC	e!Ensembl
605574	15937	ENSG00000175063

O00762

Protein name

Ubiquitin-conjugating enzyme E2 C (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme C) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme C) (UbcH10) (Ubiquitin carrier protein C) (Ubiquitin-protein ligase C)

Protein function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C),

PDB

1I7K , 4YII , 5A31 , 5KHR , 5L9U , 8TAR , 8TAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	34 → 170	Ubiquitin-conjugating enzyme	Domain

Sequence

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Sequence length

179

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Synthesis of active ubiquitin: roles of E1 and E2 enzymes Antigen processing: Ubiquitination & Proteasome degradation

UBE2C (ubiquitin conjugating enzyme E2 C)