Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11035
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor interacting serine/threonine kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIPK3
Synonyms (NCBI Gene) Gene synonyms aliases	RIP3
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q12
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytopla

Show/Hide all(87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001914	Process	Regulation of T cell mediated cytotoxicity	IEA
GO:0001914	Process	Regulation of T cell mediated cytotoxicity	ISS
GO:0002819	Process	Regulation of adaptive immune response	IEA
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0003713	Function	Transcription coactivator activity	TAS	10339433
GO:0004672	Function	Protein kinase activity	IBA
GO:0004672	Function	Protein kinase activity	IDA	22265413
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	22817896, 29883609
GO:0004672	Function	Protein kinase activity	TAS	10358032
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19524513
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	22265414
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10339433
GO:0005515	Function	Protein binding	IPI	19524512, 19524513, 19590578, 21887730, 21931591, 22265413, 22265414, 22817896, 26559832, 29883609, 30185776, 33348174, 37089942
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	30271893
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	22265413
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10339433
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032147	Process	Activation of protein kinase activity	IMP	22817896
GO:0032649	Process	Regulation of type II interferon production	IEA
GO:0032649	Process	Regulation of type II interferon production	ISS
GO:0032991	Component	Protein-containing complex	IDA	22817896
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0036211	Process	Protein modification process	TAS	10358032
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	22817896
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043029	Process	T cell homeostasis	IEA
GO:0043029	Process	T cell homeostasis	ISS
GO:0044877	Function	Protein-containing complex binding	IMP	22265414
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046006	Process	Regulation of activated T cell proliferation	IEA
GO:0046006	Process	Regulation of activated T cell proliferation	ISS
GO:0048535	Process	Lymph node development	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	21931591
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0060545	Process	Positive regulation of necroptotic process	IDA	22265414
GO:0060545	Process	Positive regulation of necroptotic process	IEA
GO:0060545	Process	Positive regulation of necroptotic process	IMP	22817896
GO:0070235	Process	Regulation of activation-induced cell death of T cells	IEA
GO:0070235	Process	Regulation of activation-induced cell death of T cells	ISS
GO:0070266	Process	Necroptotic process	IEA
GO:0070266	Process	Necroptotic process	IMP	21737330, 29883609
GO:0070266	Process	Necroptotic process	TAS
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	TAS	10339433
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0097300	Process	Programmed necrotic cell death	ISS
GO:0097527	Process	Necroptotic signaling pathway	IDA	22265413
GO:0097527	Process	Necroptotic signaling pathway	IMP	22265413, 22817896
GO:0097528	Process	Execution phase of necroptosis	IDA	24316671
GO:0097528	Process	Execution phase of necroptosis	IEA
GO:0097528	Process	Execution phase of necroptosis	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1990000	Process	Amyloid fibril formation	IMP	22817896
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA
GO:2000452	Process	Regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	IEA
GO:2000452	Process	Regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
605817	10021	ENSG00000129465

Protein

UniProt ID

Q9Y572

Protein name

Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3)

Protein function

Serine/threonine-protein kinase that activates necroptosis and apoptosis, two parallel forms of cell death (PubMed:19524512, PubMed:19524513, PubMed:22265413, PubMed:22265414, PubMed:22421439, PubMed:29883609, PubMed:32657447). Necroptosis, a pr

PDB

5V7Z , 5ZCK , 7DA4 , 7DAC , 7MON , 7MX3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	21 → 283	Protein kinase domain	Domain
PF12721	RHIM	417 → 468	RIP homotypic interaction motif	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. {ECO:0000269|PubMed:15896315}.; TISSUE SPECIFICITY: [Isoform 3]: Expression is significantly increased in colon and lung cancers. {ECO:0000

Sequence

MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK

Sequence length

518

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway TNF signaling pathway Salmonella infection		TICAM1, RIP1-mediated IKK complex recruitment RIP-mediated NFkB activation via ZBP1 TRIF-mediated programmed cell death TRP channels RIPK1-mediated regulated necrosis TLR3-mediated TICAM1-dependent programmed cell death IKK complex recruitment mediated by RIP1

RIPK3 (receptor interacting serine/threonine kinase 3)