Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11035
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor interacting serine/threonine kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIPK3
Synonyms (NCBI Gene) Gene synonyms aliases	RIP3
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q12
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytopla

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001914	Process	Regulation of T cell mediated cytotoxicity	ISS
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0003713	Function	Transcription coactivator activity	TAS	10339433
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004672	Function	Protein kinase activity	IDA	22265413
GO:0004672	Function	Protein kinase activity	IMP	22265414, 22817896, 29883609
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004704	Function	NF-kappaB-inducing kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19524512, 19524513, 19590578, 21887730, 21931591, 22265413, 22265414, 22817896, 26559832, 29883609, 30185776
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA	22265413
GO:0005829	Component	Cytosol	TAS
GO:0006464	Process	Cellular protein modification process	TAS	10358032
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IEA
GO:0010922	Process	Positive regulation of phosphatase activity	IMP	22265414
GO:0032147	Process	Activation of protein kinase activity	IMP	22817896
GO:0032649	Process	Regulation of interferon-gamma production	ISS
GO:0032991	Component	Protein-containing complex	IDA	22817896
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0038061	Process	NIK/NF-kappaB signaling	IEA
GO:0042802	Function	Identical protein binding	IPI	22817896
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043029	Process	T cell homeostasis	ISS
GO:0044877	Function	Protein-containing complex binding	IMP	22265414
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046006	Process	Regulation of activated T cell proliferation	ISS
GO:0046777	Process	Protein autophosphorylation	IDA	22265414
GO:0048535	Process	Lymph node development	ISS
GO:0048536	Process	Spleen development	ISS
GO:0048538	Process	Thymus development	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	21931591
GO:0051351	Process	Positive regulation of ligase activity	IEA
GO:0051353	Process	Positive regulation of oxidoreductase activity	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0060545	Process	Positive regulation of necroptotic process	IDA	22265414
GO:0060545	Process	Positive regulation of necroptotic process	IMP	22817896
GO:0070235	Process	Regulation of activation-induced cell death of T cells	ISS
GO:0070266	Process	Necroptotic process	IMP	21737330, 29883609
GO:0070266	Process	Necroptotic process	TAS
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0097190	Process	Apoptotic signaling pathway	TAS	10339433
GO:0097300	Process	Programmed necrotic cell death	ISS
GO:0097527	Process	Necroptotic signaling pathway	IMP	22265413, 22817896
GO:0097528	Process	Execution phase of necroptosis	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1990000	Process	Amyloid fibril formation	IMP	22817896
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA
GO:2000452	Process	Regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
605817	10021	ENSG00000129465

Protein

UniProt ID

Q9Y572

Protein name

Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3)

Protein function

Serine/threonine-protein kinase that activates necroptosis and apoptosis, two parallel forms of cell death (PubMed:19524512, PubMed:19524513, PubMed:22265413, PubMed:22265414, PubMed:22421439, PubMed:29883609, PubMed:32657447). Necroptosis, a pr

PDB

5V7Z , 5ZCK , 7DA4 , 7DAC , 7MON , 7MX3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	21 → 283	Protein kinase domain	Domain
PF12721	RHIM	417 → 468	RIP homotypic interaction motif	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. {ECO:0000269|PubMed:15896315}.; TISSUE SPECIFICITY: [Isoform 3]: Expression is significantly increased in colon and lung cancers. {ECO:0000

Sequence

MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK

Sequence length

518

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway TNF signaling pathway Salmonella infection		TICAM1, RIP1-mediated IKK complex recruitment RIP-mediated NFkB activation via ZBP1 TRIF-mediated programmed cell death TRP channels RIPK1-mediated regulated necrosis TLR3-mediated TICAM1-dependent programmed cell death IKK complex recruitment mediated by RIP1

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841 View all (4 more)	21335463

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	25888634
Adenocarcinoma of Lung	Associate	35907206
Alzheimer Disease	Associate	34625123
Atherosclerosis	Associate	29286079
Atrial Remodeling	Associate	31148336
Breast Neoplasms	Associate	24909514
Carcinoma Hepatocellular	Associate	35264437
Carcinoma Non Small Cell Lung	Associate	38126996, 39285232
Carcinoma Renal Cell	Associate	27362805, 30185776, 33786632
Carcinoma Squamous Cell	Associate	25888634
Cardiomyopathies	Stimulate	31386965
Cardiotoxicity	Associate	30086328
Cardiovascular Diseases	Associate	31148336
Chemical and Drug Induced Liver Injury	Associate	33329521
Cholangiocarcinoma	Associate	31914150, 33036630, 34083572, 37513508
Colitis Ulcerative	Stimulate	31431023
Coxa Magna	Associate	37099894
Death	Associate	30185776, 31386965, 34745115
Diabetes Mellitus	Associate	33795639
Drug Related Side Effects and Adverse Reactions	Associate	40332549
Encephalitis	Associate	37083451
Fibrocartilaginous embolism	Associate	32196619
Fibrosis	Stimulate	34498705, 37883227
Heart Diseases	Associate	31148336, 31386965
Heart Failure	Associate	28454582, 31148336, 35805993
Hemorrhage	Associate	35699825
Herpes Simplex	Associate	37083451
HIV Infections	Associate	30344003, 30653393
Hypoxia	Stimulate	35164651
Hypoxia Brain	Associate	23640464
Immunodeficiency due to Defect in MAPBP Interacting Protein	Associate	37083451
Inflammation	Associate	25748555, 31386965, 31810488, 34400895, 34498705, 37883227
Ischemia	Associate	31148336
Leukemia Lymphocytic Chronic B Cell	Associate	31142279
Leukemia Myeloid Acute	Associate	27748372
Liver Failure	Inhibit	35164651
Lung Neoplasms	Associate	38126996
Lymphoma Non Hodgkin	Associate	17827388
Melanoma	Associate	26355347, 34072104
Multiple Myeloma	Associate	40508046
Necrosis	Associate	22421439, 24336085, 25412314, 25748555
Neoplasms	Associate	25888634, 33108350, 34083572
Neoplasms	Stimulate	27362805
Osteosarcoma	Associate	40332549
Ovarian Neoplasms	Associate	25356865, 27050456
Pancreatic Neoplasms	Associate	31999765, 34462421
Prostatic Neoplasms	Associate	25412314, 33282964, 35965682
Prostatic Neoplasms Castration Resistant	Associate	25412314
Purpura Thrombocytopenic Idiopathic	Associate	35699825
Reperfusion Injury	Associate	35805993
Rufous oculocutaneous albinism	Associate	31148336
Sepsis	Associate	31386965
Squamous Cell Carcinoma of Head and Neck	Associate	33108350
ST Elevation Myocardial Infarction	Associate	27431004
Stevens Johnson Syndrome	Stimulate	25748555, 26174536
Still's Disease Adult Onset	Associate	33329521
Stomach Neoplasms	Associate	31739592
Urethral Neoplasms	Associate	33786632
Uterine Cervical Neoplasms	Associate	25888634
Ventricular Dysfunction Left	Associate	27431004

RIPK3 (receptor interacting serine/threonine kinase 3)