LILRA1 (leukocyte immunoglobulin like receptor A1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 11024
Gene name Leukocyte immunoglobulin like receptor A1
Gene symbol LILRA1
Synonyms (NCBI Gene)
CD85ILIR-6LIR6
Chromosome 19
Chromosome location 19q13.42
Summary This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompati
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT018055 hsa-miR-335-5p Microarray 18185580
MIRT1109242 hsa-miR-1324 CLIP-seq
MIRT1109243 hsa-miR-3166 CLIP-seq
MIRT1109244 hsa-miR-3662 CLIP-seq
MIRT1109245 hsa-miR-455-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0003823 Function Antigen binding TAS 9548455
GO:0004888 Function Transmembrane signaling receptor activity TAS 9548455
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
604810 6602 ENSG00000104974
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75019
Protein name Leukocyte immunoglobulin-like receptor subfamily A member 1 (CD85 antigen-like family member I) (Leukocyte immunoglobulin-like receptor 6) (LIR-6) (CD antigen CD85i)
Protein function May act as receptor for class I MHC antigens.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 → 118 Immunoglobulin domain Domain
PF13895 Ig_2 325 → 419 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in monocytes and B-cells. {ECO:0000269|PubMed:9548455}.
Sequence 
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
EAQHSQRSL
Sequence length 489
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Osteoclast differentiation
B cell receptor signaling pathway 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell