LILRA1 (leukocyte immunoglobulin like receptor A1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11024
Gene name Gene Name - the full gene name approved by the HGNC.
Leukocyte immunoglobulin like receptor A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LILRA1
Synonyms (NCBI Gene) Gene synonyms aliases
CD85I, LIR-6, LIR6
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompati
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT018055 hsa-miR-335-5p Microarray 18185580
MIRT1109242 hsa-miR-1324 CLIP-seq
MIRT1109243 hsa-miR-3166 CLIP-seq
MIRT1109244 hsa-miR-3662 CLIP-seq
MIRT1109245 hsa-miR-455-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0003823 Function Antigen binding TAS 9548455
GO:0004888 Function Transmembrane signaling receptor activity TAS 9548455
GO:0005886 Component Plasma membrane TAS
GO:0006952 Process Defense response TAS 9548455
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604810 6602 ENSG00000104974
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75019
Protein name Leukocyte immunoglobulin-like receptor subfamily A member 1 (CD85 antigen-like family member I) (Leukocyte immunoglobulin-like receptor 6) (LIR-6) (CD antigen CD85i)
Protein function May act as receptor for class I MHC antigens.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 → 118 Immunoglobulin domain Domain
PF13895 Ig_2 325 → 419 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in monocytes and B-cells. {ECO:0000269|PubMed:9548455}.
Sequence 
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
EAQHSQRSL
Sequence length 489
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Osteoclast differentiation
B cell receptor signaling pathway 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 27777418 ClinVar
Mental Depression Mental Depression GWAS