Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11010
Gene name Gene Name - the full gene name approved by the HGNC.
GLI pathogenesis related 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GLIPR1
Synonyms (NCBI Gene) Gene synonyms aliases
CRISP7, GLIPR, RTVP1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020639 hsa-miR-155-5p Proteomics 18668040
MIRT028463 hsa-miR-30a-5p Proteomics 18668040
MIRT053056 hsa-miR-137 Luciferase reporter assay, qRT-PCR, Western blot 23714687
MIRT1020966 hsa-miR-103a CLIP-seq
MIRT1020967 hsa-miR-107 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0005615 Component Extracellular space IBA 21873635
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane HDA 19946888
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602692 17001 ENSG00000139278
Protein
UniProt ID P48060
Protein name Glioma pathogenesis-related protein 1 (GliPR 1) (Protein RTVP-1)
PDB 3Q2R , 3Q2U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00188 CAP 38 175 Cysteine-rich secretory protein family Domain
Tissue specificity TISSUE SPECIFICITY: According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-
Sequence
MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTW
DPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDE
IQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNY
GPGGN
YPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV
NSVILILSVIITILVQHKYPNLVLLD
Sequence length 266
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PPARA activates gene expression
Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Nephroblastoma Nephroblastoma rs1553551874, rs1555913934, rs769116796 18030365
Wilms tumor Bilateral Wilms Tumor rs121918261, rs2116574924, rs587776573, rs587776574, rs121907900, rs121907901, rs587776576, rs121907909, rs121907906, rs587776577, rs121907911, rs80359604, rs80358785, rs104894855, rs122453119
View all (13 more)
18030365
Associations from Text Mining
Disease Name Relationship Type References
Amyloidosis Associate 27069257
Autism Spectrum Disorder Associate 26398136
Brain Neoplasms Stimulate 21931216
Glioblastoma Stimulate 21045302
Glioblastoma Associate 21931216, 26305187
Glioma Associate 26305187
Influenza Human Stimulate 21933889
Lung Neoplasms Associate 28771580
Neoplasms Inhibit 18030365, 21933889, 23333597
Photophobia Associate 21933889