Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11004
Gene name Gene Name - the full gene name approved by the HGNC.	Kinesin family member 2C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KIF2C
Synonyms (NCBI Gene) Gene synonyms aliases	CT139, KNSL6, MCAK
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multip

Show/Hide all(185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016679	hsa-miR-423-3p	Sequencing	20371350
MIRT019473	hsa-miR-148b-3p	Microarray	17612493
MIRT023058	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024025	hsa-miR-1-3p	Proteomics	18668040
MIRT025335	hsa-miR-34a-5p	Proteomics	21566225
MIRT025335	hsa-miR-34a-5p	Proteomics	21566225
MIRT027317	hsa-miR-101-3p	Sequencing	20371350
MIRT031974	hsa-miR-16-5p	Proteomics	18668040
MIRT050506	hsa-miR-20a-5p	CLASH	23622248
MIRT049563	hsa-miR-92a-3p	CLASH	23622248
MIRT138452	hsa-miR-4484	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	PAR-CLIP	23592263
MIRT138428	hsa-miR-181b-5p	PAR-CLIP	23592263
MIRT138429	hsa-miR-181c-5p	PAR-CLIP	23592263
MIRT138435	hsa-miR-181d-5p	PAR-CLIP	23592263
MIRT138449	hsa-miR-4262	PAR-CLIP	23592263
MIRT138447	hsa-miR-3154	PAR-CLIP	23592263
MIRT138463	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT138426	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT019473	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT138430	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT138432	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT138460	hsa-miR-6075	PAR-CLIP	23592263
MIRT016679	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT138446	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT138464	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT455914	hsa-miR-4276	PAR-CLIP	23592263
MIRT455913	hsa-miR-1303	PAR-CLIP	23592263
MIRT138440	hsa-miR-583	PAR-CLIP	23592263
MIRT455912	hsa-miR-548a-5p	PAR-CLIP	23592263
MIRT455911	hsa-miR-548ab	PAR-CLIP	23592263
MIRT455910	hsa-miR-548ad-5p	PAR-CLIP	23592263
MIRT455909	hsa-miR-548ae-5p	PAR-CLIP	23592263
MIRT455908	hsa-miR-548ak	PAR-CLIP	23592263
MIRT455907	hsa-miR-548am-5p	PAR-CLIP	23592263
MIRT455906	hsa-miR-548ap-5p	PAR-CLIP	23592263
MIRT455905	hsa-miR-548aq-5p	PAR-CLIP	23592263
MIRT455904	hsa-miR-548ar-5p	PAR-CLIP	23592263
MIRT455903	hsa-miR-548as-5p	PAR-CLIP	23592263
MIRT455902	hsa-miR-548au-5p	PAR-CLIP	23592263
MIRT455901	hsa-miR-548ay-5p	PAR-CLIP	23592263
MIRT455900	hsa-miR-548b-5p	PAR-CLIP	23592263
MIRT455899	hsa-miR-548bb-5p	PAR-CLIP	23592263
MIRT455898	hsa-miR-548c-5p	PAR-CLIP	23592263
MIRT455897	hsa-miR-548d-5p	PAR-CLIP	23592263
MIRT455896	hsa-miR-548h-5p	PAR-CLIP	23592263
MIRT455895	hsa-miR-548i	PAR-CLIP	23592263
MIRT455894	hsa-miR-548j-5p	PAR-CLIP	23592263
MIRT455893	hsa-miR-548o-5p	PAR-CLIP	23592263
MIRT455892	hsa-miR-548w	PAR-CLIP	23592263
MIRT455891	hsa-miR-548y	PAR-CLIP	23592263
MIRT455890	hsa-miR-559	PAR-CLIP	23592263
MIRT138459	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT138444	hsa-miR-548k	PAR-CLIP	23592263
MIRT138465	hsa-miR-8054	PAR-CLIP	23592263
MIRT455889	hsa-miR-548l	PAR-CLIP	23592263
MIRT138462	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455888	hsa-miR-1321	PAR-CLIP	23592263
MIRT455887	hsa-miR-4739	PAR-CLIP	23592263
MIRT455886	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT138451	hsa-miR-3675-3p	PAR-CLIP	23592263
MIRT138439	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT455885	hsa-miR-4330	PAR-CLIP	23592263
MIRT455884	hsa-miR-517-5p	PAR-CLIP	23592263
MIRT455883	hsa-miR-1251-5p	PAR-CLIP	23592263
MIRT138434	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT138455	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT138453	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT138448	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT455882	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT455881	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT138428	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT138429	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT138435	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT138452	hsa-miR-4484	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	PAR-CLIP	23592263
MIRT138428	hsa-miR-181b-5p	PAR-CLIP	23592263
MIRT138429	hsa-miR-181c-5p	PAR-CLIP	23592263
MIRT138435	hsa-miR-181d-5p	PAR-CLIP	23592263
MIRT138449	hsa-miR-4262	PAR-CLIP	23592263
MIRT138447	hsa-miR-3154	PAR-CLIP	23592263
MIRT138463	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT138426	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT019473	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT138430	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT138432	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT138460	hsa-miR-6075	PAR-CLIP	23592263
MIRT016679	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT138446	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT138464	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT455914	hsa-miR-4276	PAR-CLIP	23592263
MIRT455913	hsa-miR-1303	PAR-CLIP	23592263
MIRT138440	hsa-miR-583	PAR-CLIP	23592263
MIRT455912	hsa-miR-548a-5p	PAR-CLIP	23592263
MIRT455911	hsa-miR-548ab	PAR-CLIP	23592263
MIRT455910	hsa-miR-548ad-5p	PAR-CLIP	23592263
MIRT455909	hsa-miR-548ae-5p	PAR-CLIP	23592263
MIRT455908	hsa-miR-548ak	PAR-CLIP	23592263
MIRT455907	hsa-miR-548am-5p	PAR-CLIP	23592263
MIRT455906	hsa-miR-548ap-5p	PAR-CLIP	23592263
MIRT455905	hsa-miR-548aq-5p	PAR-CLIP	23592263
MIRT455904	hsa-miR-548ar-5p	PAR-CLIP	23592263
MIRT455903	hsa-miR-548as-5p	PAR-CLIP	23592263
MIRT455902	hsa-miR-548au-5p	PAR-CLIP	23592263
MIRT455901	hsa-miR-548ay-5p	PAR-CLIP	23592263
MIRT455900	hsa-miR-548b-5p	PAR-CLIP	23592263
MIRT455899	hsa-miR-548bb-5p	PAR-CLIP	23592263
MIRT455898	hsa-miR-548c-5p	PAR-CLIP	23592263
MIRT455897	hsa-miR-548d-5p	PAR-CLIP	23592263
MIRT455896	hsa-miR-548h-5p	PAR-CLIP	23592263
MIRT455895	hsa-miR-548i	PAR-CLIP	23592263
MIRT455894	hsa-miR-548j-5p	PAR-CLIP	23592263
MIRT455893	hsa-miR-548o-5p	PAR-CLIP	23592263
MIRT455892	hsa-miR-548w	PAR-CLIP	23592263
MIRT455891	hsa-miR-548y	PAR-CLIP	23592263
MIRT455890	hsa-miR-559	PAR-CLIP	23592263
MIRT138459	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT138444	hsa-miR-548k	PAR-CLIP	23592263
MIRT138465	hsa-miR-8054	PAR-CLIP	23592263
MIRT455889	hsa-miR-548l	PAR-CLIP	23592263
MIRT138462	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455888	hsa-miR-1321	PAR-CLIP	23592263
MIRT455887	hsa-miR-4739	PAR-CLIP	23592263
MIRT455886	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT138451	hsa-miR-3675-3p	PAR-CLIP	23592263
MIRT138439	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT455885	hsa-miR-4330	PAR-CLIP	23592263
MIRT455884	hsa-miR-517-5p	PAR-CLIP	23592263
MIRT455883	hsa-miR-1251-5p	PAR-CLIP	23592263
MIRT138434	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT138455	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT138453	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT138448	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT455882	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT455881	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT1094541	hsa-miR-136	CLIP-seq
MIRT1094542	hsa-miR-146b-3p	CLIP-seq
MIRT1094543	hsa-miR-1915	CLIP-seq
MIRT1094544	hsa-miR-22	CLIP-seq
MIRT1094545	hsa-miR-2355-5p	CLIP-seq
MIRT1094546	hsa-miR-296-5p	CLIP-seq
MIRT1094547	hsa-miR-3134	CLIP-seq
MIRT1094548	hsa-miR-3173-5p	CLIP-seq
MIRT1094549	hsa-miR-3688-3p	CLIP-seq
MIRT1094550	hsa-miR-3978	CLIP-seq
MIRT1094551	hsa-miR-4270	CLIP-seq
MIRT1094552	hsa-miR-4292	CLIP-seq
MIRT1094553	hsa-miR-4300	CLIP-seq
MIRT1094554	hsa-miR-4441	CLIP-seq
MIRT1094555	hsa-miR-4534	CLIP-seq
MIRT1094556	hsa-miR-4640-3p	CLIP-seq
MIRT1094557	hsa-miR-4780	CLIP-seq
MIRT1094558	hsa-miR-874	CLIP-seq
MIRT1094559	hsa-miR-885-5p	CLIP-seq
MIRT1094560	hsa-miR-920	CLIP-seq
MIRT2025322	hsa-miR-4728-3p	CLIP-seq
MIRT1094542	hsa-miR-146b-3p	CLIP-seq
MIRT2256591	hsa-miR-148a	CLIP-seq
MIRT2256592	hsa-miR-148b	CLIP-seq
MIRT2256593	hsa-miR-152	CLIP-seq
MIRT2256594	hsa-miR-181a	CLIP-seq
MIRT2256595	hsa-miR-181b	CLIP-seq
MIRT2256596	hsa-miR-181c	CLIP-seq
MIRT2256597	hsa-miR-181d	CLIP-seq
MIRT1094544	hsa-miR-22	CLIP-seq
MIRT1094545	hsa-miR-2355-5p	CLIP-seq
MIRT1094548	hsa-miR-3173-5p	CLIP-seq
MIRT2256598	hsa-miR-3617	CLIP-seq
MIRT2256599	hsa-miR-4256	CLIP-seq
MIRT2256600	hsa-miR-4514	CLIP-seq
MIRT2256601	hsa-miR-455-3p	CLIP-seq
MIRT2256602	hsa-miR-4639-3p	CLIP-seq
MIRT1094556	hsa-miR-4640-3p	CLIP-seq
MIRT2256603	hsa-miR-4676-5p	CLIP-seq
MIRT2256604	hsa-miR-4692	CLIP-seq
MIRT2256605	hsa-miR-4714-5p	CLIP-seq
MIRT2256606	hsa-miR-548h	CLIP-seq
MIRT2256607	hsa-miR-548j	CLIP-seq
MIRT2256608	hsa-miR-575	CLIP-seq
MIRT2256609	hsa-miR-641	CLIP-seq
MIRT2256610	hsa-miR-668	CLIP-seq
MIRT1094558	hsa-miR-874	CLIP-seq
MIRT1094559	hsa-miR-885-5p	CLIP-seq
MIRT2389869	hsa-miR-658	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
E2F1	Activation	23610368
E2F1	Repression	18440323
SP1	Activation	18440323

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IDA	14960279
GO:0000776	Component	Kinetochore	IDA	23891108
GO:0000776	Component	Kinetochore	IDA	14960279
GO:0000777	Component	Condensed chromosome kinetochore	IEA
GO:0003777	Function	Microtubule motor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11092768, 19543227, 19632184, 21820309, 26496610, 27173435
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005819	Component	Spindle	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005871	Component	Kinesin complex	IBA	21873635
GO:0005874	Component	Microtubule	IBA	21873635
GO:0005881	Component	Cytoplasmic microtubule	ISS
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS
GO:0007018	Process	Microtubule-based movement	IBA	21873635
GO:0007018	Process	Microtubule-based movement	TAS
GO:0007019	Process	Microtubule depolymerization	IDA	21820309
GO:0007019	Process	Microtubule depolymerization	IMP	19060894
GO:0007019	Process	Microtubule depolymerization	TAS	26323690
GO:0007080	Process	Mitotic metaphase plate congression	IMP	15843429
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATPase activity	IBA	21873635
GO:0019237	Function	Centromeric DNA binding	TAS	9434124
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IMP	14718566
GO:0035371	Component	Microtubule plus-end	IDA	21820309, 23891108
GO:0035371	Component	Microtubule plus-end	TAS	26323690
GO:0051010	Function	Microtubule plus-end binding	IDA	19632184
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase plate congression	IMP	23891108
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	23891108
GO:0051983	Process	Regulation of chromosome segregation	IMP	19060894

MIM	HGNC	e!Ensembl
604538	6393	ENSG00000142945

Protein

UniProt ID

Q99661

Protein name

Kinesin-like protein KIF2C (Kinesin-like protein 6) (Mitotic centromere-associated kinesin) (MCAK)

Protein function

In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells (PubMed:21820309). Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis (PubM

PDB

2HEH , 4UBF , 4Y05 , 5MIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	264 → 588	Kinesin motor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes

Sequence

MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDD
VAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSEL
RITAQENDMEVELPAAANSRKQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSS
SANPVNSVRRKSCLVKEVEKMKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFR
ATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL
TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGG
DLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLR
VLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRA
KGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFR
ESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI
QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGP
DWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKALRLAMQLEEQASRQISS
KKRPQ

Sequence length

725

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins COPI-dependent Golgi-to-ER retrograde traffic Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation Kinesins

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Show/Hide Text Mining Associations (47)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	30883337, 33187219
Breast Neoplasms	Stimulate	17944972
Breast Neoplasms	Associate	21679412, 23610368, 28754978, 30593585, 31285741, 34384030, 35456460, 37016301
Carcinogenesis	Associate	17944972
Carcinoma Hepatocellular	Associate	28901309, 35915607, 36032071
Carcinoma Non Small Cell Lung	Associate	33126319, 34369264
Carcinoma Non Small Cell Lung	Stimulate	37142638
Carcinoma Renal Cell	Associate	28260099, 36793506, 37863123
Cardiovascular Diseases	Associate	18222353
Chromosomal Instability	Associate	19879145, 27881713
Chromosome Aberrations	Associate	19060894
Colorectal Neoplasms	Associate	18506187, 26148251
Coronary Disease	Associate	18222353, 21435211
COVID 19	Associate	33839760, 35749386
Diabetes Gestational	Associate	30474315
Down Syndrome	Associate	30763715
Esophageal Squamous Cell Carcinoma	Associate	27563815, 37968758
Glioblastoma	Associate	35387222
Glioma	Associate	35387222
Graft vs Host Disease	Associate	39201599
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17944972
Infertility Male	Associate	34591790
Klinefelter Syndrome	Associate	35622500
Leukemia	Associate	14749730
Lung Neoplasms	Associate	31789390, 32831194
Lymphatic Metastasis	Stimulate	17653072, 18506187, 35720323
Lymphatic Metastasis	Associate	26148251, 27563815
Myocardial Infarction	Associate	18222353
Neoplasm Invasiveness	Stimulate	18506187
Neoplasm Metastasis	Associate	28281966, 31285741, 36923927
Neoplasm Metastasis	Stimulate	37863123
Neoplasms	Associate	17653072, 21078677, 21169070, 25002494, 25074805, 26148251, 27563815, 30883337, 31746663, 32461543, 34369264, 35720323, 36029726, 37016301, 37833711
Neoplasms	Stimulate	37863123
Neuroectodermal Tumors Primitive	Associate	36524840
Ovarian Neoplasms	Associate	34253236
Pancreatic Neoplasms	Associate	36029726
Panic Disorder	Associate	26283638
Peritonitis	Stimulate	18506187
Prostatic Neoplasms	Associate	22363599, 35720323, 37916740, 39201599
Prostatic Neoplasms Castration Resistant	Associate	22363599
Schizophrenia Disorganized	Associate	14749730
Squamous Cell Carcinoma of Head and Neck	Associate	33315534
Stomach Neoplasms	Associate	17653072, 24628949
Testicular Neoplasms	Associate	17944972, 34591790
Thyroid Carcinoma Anaplastic	Associate	33025856
Triple Negative Breast Neoplasms	Associate	32766313
Wilms Tumor	Associate	37717078

KIF2C (kinesin family member 2C)