Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	11001
Gene name	Solute carrier family 27 member 2
Gene symbol	SLC27A2
Synonyms (NCBI Gene)	ACSVL1FACVL1FATP2HsT17226VLACSVLCShFACVL1
Chromosome	15
Chromosome location	15q21.2
Summary	The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty aci

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020494	hsa-miR-155-5p	Proteomics	18668040
MIRT032206	hsa-let-7b-5p	Proteomics	18668040
MIRT649361	hsa-miR-3184-3p	HITS-CLIP	23824327
MIRT649360	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649359	hsa-miR-4469	HITS-CLIP	23824327
MIRT649358	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT649357	hsa-miR-4287	HITS-CLIP	23824327
MIRT649356	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT649355	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT649354	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT649353	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT649361	hsa-miR-3184-3p	HITS-CLIP	23824327
MIRT649360	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649359	hsa-miR-4469	HITS-CLIP	23824327
MIRT649358	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT649357	hsa-miR-4287	HITS-CLIP	23824327
MIRT649356	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT649355	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT649354	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT649353	hsa-miR-6867-3p	HITS-CLIP	23824327

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001561	Process	Fatty acid alpha-oxidation	IDA	10198260
GO:0001561	Process	Fatty acid alpha-oxidation	TAS
GO:0001676	Process	Long-chain fatty acid metabolic process	IBA
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	22022213
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IBA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	10198260, 10749848, 22022213
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IBA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IDA	20530735, 21768100
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IBA
GO:0005778	Component	Peroxisomal membrane	IDA	10198260, 10640429
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IDA	10198260
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	11980911, 22022213
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	IDA	10198260
GO:0006699	Process	Bile acid biosynthetic process	IDA	11980911
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0008206	Process	Bile acid metabolic process	IBA
GO:0015245	Function	Fatty acid transmembrane transporter activity	IEA
GO:0015908	Process	Fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	16781659
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	EXP	10198260
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IDA	10198260, 10749848, 11980911, 21768100
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IEA
GO:0033540	Process	Fatty acid beta-oxidation using acyl-CoA oxidase	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0042760	Process	Very long-chain fatty acid catabolic process	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	IBA
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	22022213
GO:0046949	Process	Fatty-acyl-CoA biosynthetic process	TAS
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA
GO:0047747	Function	Cholate-CoA ligase activity	IEA
GO:0050197	Function	Phytanate-CoA ligase activity	EXP	10198260
GO:0050197	Function	Phytanate-CoA ligase activity	IDA	10198260
GO:0050197	Function	Phytanate-CoA ligase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070251	Function	Pristanate-CoA ligase activity	EXP	9662422
GO:0070251	Function	Pristanate-CoA ligase activity	IDA	10198260
GO:0070251	Function	Pristanate-CoA ligase activity	IEA
GO:0097089	Process	Methyl-branched fatty acid metabolic process	IDA	10198260

MIM	HGNC	e!Ensembl
603247	10996	ENSG00000140284

O14975

Protein name

Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2

Protein function

Mediates the import of long-chain fatty acids (LCFA) into the cell by facilitating their transport across cell membranes, playing an important role in hepatic fatty acid uptake (PubMed:10198260, PubMed:10749848, PubMed:11980911, PubMed:20530735,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00501	AMP-binding	59 → 488	AMP-binding enzyme	Family
PF13193	AMP-binding_C	496 → 572	AMP-binding enzyme C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in liver, kidney, placenta, intestine, brain, heart, and colon (PubMed:10198260, PubMed:21768100, PubMed:24269233). Predominantly expressed in liver (PubMed:20530735). {ECO:0000269|PubMed:10198260, ECO:0000269|Pu

Sequence

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL

Sequence length

620

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Peroxisome Insulin resistance		Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol Synthesis of bile acids and bile salts via 24-hydroxycholesterol Alpha-oxidation of phytanate Neutrophil degranulation Peroxisomal protein import

SLC27A2 (solute carrier family 27 member 2)