Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11001
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 27 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC27A2
Synonyms (NCBI Gene) Gene synonyms aliases	ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty aci

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020494	hsa-miR-155-5p	Proteomics	18668040
MIRT032206	hsa-let-7b-5p	Proteomics	18668040
MIRT649361	hsa-miR-3184-3p	HITS-CLIP	23824327
MIRT649360	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649359	hsa-miR-4469	HITS-CLIP	23824327
MIRT649358	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT649357	hsa-miR-4287	HITS-CLIP	23824327
MIRT649356	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT649355	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT649354	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT649353	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT649361	hsa-miR-3184-3p	HITS-CLIP	23824327
MIRT649360	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649359	hsa-miR-4469	HITS-CLIP	23824327
MIRT649358	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT649357	hsa-miR-4287	HITS-CLIP	23824327
MIRT649356	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT649355	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT649354	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT649353	hsa-miR-6867-3p	HITS-CLIP	23824327

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001561	Process	Fatty acid alpha-oxidation	IDA	10198260
GO:0001561	Process	Fatty acid alpha-oxidation	TAS
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	22022213
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IBA	21873635
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	10198260, 10749848, 22022213
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS
GO:0005324	Function	Long-chain fatty acid transporter activity	IBA	21873635
GO:0005324	Function	Long-chain fatty acid transporter activity	IDA	20530735, 21768100
GO:0005524	Function	ATP binding	IEA
GO:0005778	Component	Peroxisomal membrane	IDA	10640429
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0005779	Component	Integral component of peroxisomal membrane	IBA	21873635
GO:0005779	Component	Integral component of peroxisomal membrane	IDA	10198260
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005788	Component	Endoplasmic reticulum lumen	IBA	21873635
GO:0005788	Component	Endoplasmic reticulum lumen	IDA	10198260
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22022213
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0006635	Process	Fatty acid beta-oxidation	IDA	10198260
GO:0006699	Process	Bile acid biosynthetic process	IBA	21873635
GO:0006699	Process	Bile acid biosynthetic process	IDA	11980911
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0015245	Function	Fatty acid transmembrane transporter activity	IBA	21873635
GO:0019899	Function	Enzyme binding	IPI	16781659
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IBA	21873635
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IDA	11980911
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IBA	21873635
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IDA	10198260, 10749848, 11980911, 21768100
GO:0035579	Component	Specific granule membrane	TAS
GO:0042760	Process	Very long-chain fatty acid catabolic process	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044539	Process	Long-chain fatty acid import into cell	IBA	21873635
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	22022213
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA
GO:0047747	Function	Cholate-CoA ligase activity	IEA
GO:0050197	Function	Phytanate-CoA ligase activity	IBA	21873635
GO:0050197	Function	Phytanate-CoA ligase activity	IDA	10198260
GO:0050197	Function	Phytanate-CoA ligase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070251	Function	Pristanate-CoA ligase activity	IBA	21873635
GO:0070251	Function	Pristanate-CoA ligase activity	IDA	10198260
GO:0070251	Function	Pristanate-CoA ligase activity	TAS
GO:0097089	Process	Methyl-branched fatty acid metabolic process	IDA	10198260

MIM	HGNC	e!Ensembl
603247	10996	ENSG00000140284

Protein

UniProt ID

O14975

Protein name

Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2

Protein function

Mediates the import of long-chain fatty acids (LCFA) into the cell by facilitating their transport across cell membranes, playing an important role in hepatic fatty acid uptake (PubMed:10198260, PubMed:10749848, PubMed:11980911, PubMed:20530735,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00501	AMP-binding	59 → 488	AMP-binding enzyme	Family
PF13193	AMP-binding_C	496 → 572	AMP-binding enzyme C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in liver, kidney, placenta, intestine, brain, heart, and colon (PubMed:10198260, PubMed:21768100, PubMed:24269233). Predominantly expressed in liver (PubMed:20530735). {ECO:0000269|PubMed:10198260, ECO:0000269|Pu

Sequence

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL

Sequence length

620

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Peroxisome Insulin resistance		Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol Synthesis of bile acids and bile salts via 24-hydroxycholesterol Alpha-oxidation of phytanate Neutrophil degranulation Peroxisomal protein import

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Cirrhosis	Cirrhosis		28871336	ClinVar

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	36869083
Carcinoma Hepatocellular	Associate	22022213
Carcinoma Pancreatic Ductal	Associate	40269781
Carcinoma Squamous Cell	Associate	39738606
Colorectal Neoplasms	Associate	37041476
Diabetes Gestational	Inhibit	24262292
Hyperinsulinism	Associate	22471940
Neoplasms	Stimulate	34854499
Neoplasms	Associate	37041476
Obesity	Associate	22278432
Obesity	Stimulate	27016784
Obesity Maternal	Inhibit	24262292
Overweight	Inhibit	22278432
Overweight	Associate	27016784
Thyroid Neoplasms	Stimulate	34854499

SLC27A2 (solute carrier family 27 member 2)