Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10998
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 27 member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC27A5
Synonyms (NCBI Gene) Gene synonyms aliases	ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.43
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IBA	21873635
GO:0000038	Process	Very long-chain fatty acid metabolic process	IDA	10479480
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IBA	21873635
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	TAS
GO:0005324	Function	Long-chain fatty acid transporter activity	IBA	21873635
GO:0005324	Function	Long-chain fatty acid transporter activity	IDA	20530735
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA	10479480
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006642	Process	Triglyceride mobilization	IBA	21873635
GO:0006699	Process	Bile acid biosynthetic process	IBA	21873635
GO:0006699	Process	Bile acid biosynthetic process	IDA	11980911
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015245	Function	Fatty acid transmembrane transporter activity	IBA	21873635
GO:0015721	Process	Bile acid and bile salt transport	TAS
GO:0015911	Process	Long-chain fatty acid import across plasma membrane	IBA	21873635
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IBA	21873635
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IDA	11980911
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IDA	10479480, 11980911
GO:0032991	Component	Protein-containing complex	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046951	Process	Ketone body biosynthetic process	IBA	21873635
GO:0047747	Function	Cholate-CoA ligase activity	IDA	10749848

MIM	HGNC	e!Ensembl
603314	10999	ENSG00000083807

Protein

UniProt ID

Q9Y2P5

Protein name

Long-chain fatty acid transport protein 5 (FATP-5) (Fatty acid transport protein 5) (Bile acid-CoA ligase) (BA-CoA ligase) (BAL) (Bile acyl-CoA synthetase) (BACS) (EC 6.2.1.7) (Cholate--CoA ligase) (Fatty-acid-coenzyme A ligase, very long-chain 3) (Long-c

Protein function

May mediate the import of long-chain fatty acids (LCFA) by facilitating their transport across cell membranes (PubMed:20448275, PubMed:20530735). Also catalyzes the ATP-dependent formation of fatty acyl-CoA using LCFA and very-long-chain fatty a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00501	AMP-binding	120 → 558	AMP-binding enzyme	Family
PF13193	AMP-binding_C	566 → 642	AMP-binding enzyme C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in liver. {ECO:0000269|PubMed:10479480}.

Sequence

MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWV
PHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAF
ERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVL
ASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILP
KLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAP
KFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDN
QGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMD
REGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
PLFVLDNRAQSFRPLTAEMYQAVCEGTWRL

Sequence length

690

Interactions

View interactions

	KEGG		Reactome
	Primary bile acid biosynthesis Metabolic pathways PPAR signaling pathway Insulin resistance Bile secretion		Recycling of bile acids and salts Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol Synthesis of bile acids and bile salts via 24-hydroxycholesterol

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Adrenoleukodystrophy	Associate	30544401
Carcinoma Hepatocellular	Associate	34664394, 34861383, 36635256, 38157255
Carcinoma Hepatocellular	Inhibit	38059827
Cholestasis Intrahepatic	Associate	22783059
Neoplasm Metastasis	Associate	38059827
Neoplastic Cells Circulating	Associate	34664394
Non alcoholic Fatty Liver Disease	Associate	27301979
Pulmonary Disease Chronic Obstructive	Stimulate	40655182

SLC27A5 (solute carrier family 27 member 5)