Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10987
Gene name Gene Name - the full gene name approved by the HGNC.	COP9 signalosome subunit 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COPS5
Synonyms (NCBI Gene) Gene synonyms aliases	CSN5, JAB1, MOV-34, SGN5
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031695	hsa-miR-16-5p	Proteomics	18668040
MIRT047407	hsa-miR-10b-5p	CLASH	23622248
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT2203927	hsa-miR-106a	CLIP-seq
MIRT2203928	hsa-miR-106b	CLIP-seq
MIRT2203929	hsa-miR-1197	CLIP-seq
MIRT2203930	hsa-miR-1225-5p	CLIP-seq
MIRT2203931	hsa-miR-1276	CLIP-seq
MIRT2203932	hsa-miR-17	CLIP-seq
MIRT2203933	hsa-miR-20a	CLIP-seq
MIRT2203934	hsa-miR-20b	CLIP-seq
MIRT2203935	hsa-miR-3117-3p	CLIP-seq
MIRT2203936	hsa-miR-3609	CLIP-seq
MIRT2203937	hsa-miR-3663-3p	CLIP-seq
MIRT2203938	hsa-miR-4311	CLIP-seq
MIRT2203939	hsa-miR-4700-3p	CLIP-seq
MIRT2203940	hsa-miR-4796-3p	CLIP-seq
MIRT2203941	hsa-miR-5095	CLIP-seq
MIRT2203942	hsa-miR-519d	CLIP-seq
MIRT2203943	hsa-miR-548ah	CLIP-seq
MIRT2203944	hsa-miR-555	CLIP-seq
MIRT2203945	hsa-miR-556-3p	CLIP-seq
MIRT2203946	hsa-miR-579	CLIP-seq
MIRT2203947	hsa-miR-582-3p	CLIP-seq
MIRT2203948	hsa-miR-583	CLIP-seq
MIRT2203949	hsa-miR-651	CLIP-seq
MIRT2203950	hsa-miR-889	CLIP-seq
MIRT2203951	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
GATA1	Unknown	21689417
STAT3	Unknown	21689417

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000338	Process	Protein deneddylation	IBA	21873635
GO:0000338	Process	Protein deneddylation	IDA	19141280
GO:0000338	Process	Protein deneddylation	IMP	19214193
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000785	Component	Chromatin	IDA	20978819
GO:0003713	Function	Transcription coactivator activity	TAS	8837781
GO:0003743	Function	Translation initiation factor activity	TAS	9341143
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IDA	19246649
GO:0005515	Function	Protein binding	IPI	12082530, 14993265, 15234121, 15480426, 15887118, 16300740, 16410250, 17050680, 18850735, 19214193, 19444310, 19615732, 20399188, 20978819, 21145461, 21499297, 21625211, 23776465, 23840749, 24421388, 25043011, 26456823, 27029275, 28514442, 32296183
GO:0005634	Component	Nucleus	IDA	16300740, 17050680, 20978819
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	16300740, 17050680
GO:0005829	Component	Cytosol	IDA	20978819
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	TAS	9341143
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006412	Process	Translation	TAS	9341143
GO:0006413	Process	Translational initiation	IEA
GO:0008021	Component	Synaptic vesicle	IDA	21102408
GO:0008180	Component	COP9 signalosome	IBA	21873635
GO:0008180	Component	COP9 signalosome	IDA	18850735, 19214193
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	IMP	19214193
GO:0016579	Process	Protein deubiquitination	IDA	19246649
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0019784	Function	NEDD8-specific protease activity	IBA	21873635
GO:0019784	Function	NEDD8-specific protease activity	TAS
GO:0019899	Function	Enzyme binding	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20978819
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16410250
GO:0046328	Process	Regulation of JNK cascade	IDA	16410250
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16300740
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	20978819
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070122	Function	Isopeptidase activity	IEA
GO:1903894	Process	Regulation of IRE1-mediated unfolded protein response	IMP	15234121
GO:1990182	Process	Exosomal secretion	IDA	19246649

MIM	HGNC	e!Ensembl
604850	2240	ENSG00000121022

Protein

UniProt ID

Q92905

Protein name

COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1)

Protein function

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylat

PDB

4D10 , 4D18 , 4F7O , 4WSN , 5JOG , 5JOH , 5M5Q , 6R6H , 6R7F , 6R7H , 6R7I , 8H38 , 8H3A , 8H3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	50 → 164	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
PF18323	CSN5_C	251 → 329	Cop9 signalosome subunit 5 C-terminal domain	Domain

Sequence

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Sequence length

334

Interactions

View interactions

	Reactome
			DNA Damage Recognition in GG-NER Formation of TC-NER Pre-Incision Complex Cargo recognition for clathrin-mediated endocytosis Neddylation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Joubert syndrome	JOUBERT SYNDROME 21	rs201108965, rs13297509, rs121918128, rs121918129, rs121918130, rs2109050324, rs118204052, rs118204053, rs121918197, rs121918198, rs121918199, rs121918200, rs121918204, rs387906243, rs145665129 View all (432 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	35311290
Arthritis Rheumatoid	Associate	16936264
Ataxia Neuropathy Spectrum	Stimulate	29038283
Breast Neoplasms	Associate	15217497, 16518402, 18246048, 18534028, 21689417, 27375289
Calcinosis Cutis	Associate	15154004
Carcinogenesis	Associate	15082527, 17052710, 22668871
Carcinoma Ductal Breast	Associate	15217497
Carcinoma Hepatocellular	Associate	20890423, 21499307
Carcinoma Non Small Cell Lung	Associate	16721818, 35311290
Carcinoma Pancreatic Ductal	Associate	36905103
Carcinoma Squamous Cell	Inhibit	35311290
Cholangitis	Associate	29038283
Colorectal Neoplasms	Associate	22668871, 26045788
Diabetic Nephropathies	Associate	35439852
Dysplastic Nevus Syndrome	Associate	15154004
Esophageal Squamous Cell Carcinoma	Associate	34148879
Hypobetalipoproteinemia Familial Apolipoprotein B	Associate	16936264
Hypoxia	Associate	11707426, 22901179
Hypoxia Brain	Associate	15082527
Inflammation	Stimulate	27960080
Inflammation	Associate	35439852
Leukemia	Associate	28270496
Leukemia Monocytic Acute	Associate	28270496
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15353483
Lung Neoplasms	Associate	22901179, 28592245, 35311290
Lymphatic Metastasis	Associate	16619581
Lymphoma Non Hodgkin	Associate	18285702
Melanoma	Associate	15154004
N syndrome	Associate	15126503
Nasopharyngeal Carcinoma	Associate	22350412, 22797071, 25607111, 36618352
Nasopharyngeal Carcinoma	Stimulate	23815987
Neoplasm Metastasis	Associate	35342335
Neoplasms	Associate	15082527, 16619581, 16721818, 16951171, 17052710, 18285702, 18534028, 19461157, 21689417, 22350412, 22668871, 22797071, 26045788, 27626169, 27903243 View all (4 more)
Neoplasms	Inhibit	35311290
Nevus	Associate	15154004
Nevus Pigmented	Associate	15154004
Pancreatic Neoplasms	Associate	16951171, 26464677
Primary Ovarian Insufficiency	Associate	32143396
Prostatic Neoplasms	Associate	24725084
Rhabdomyosarcoma	Associate	12359053
Rhabdomyosarcoma Embryonal	Associate	12359053
Sarcoma	Associate	23071715
Squamous Cell Carcinoma of Head and Neck	Associate	16619581, 36618352
Thyroid Cancer Papillary	Associate	19461157
Triple Negative Breast Neoplasms	Associate	35342335
Uterine Cervical Neoplasms	Associate	34577000

COPS5 (COP9 signalosome subunit 5)