Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	10987
Gene name	COP9 signalosome subunit 5
Gene symbol	COPS5
Synonyms (NCBI Gene)	CSN5JAB1MOV-34SGN5
Chromosome	8
Chromosome location	8q13.1
Summary	The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031695	hsa-miR-16-5p	Proteomics	18668040
MIRT047407	hsa-miR-10b-5p	CLASH	23622248
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT731966	hsa-miR-24-3p	Luciferase reporter assay	27157611
MIRT2203927	hsa-miR-106a	CLIP-seq
MIRT2203928	hsa-miR-106b	CLIP-seq
MIRT2203929	hsa-miR-1197	CLIP-seq
MIRT2203930	hsa-miR-1225-5p	CLIP-seq
MIRT2203931	hsa-miR-1276	CLIP-seq
MIRT2203932	hsa-miR-17	CLIP-seq
MIRT2203933	hsa-miR-20a	CLIP-seq
MIRT2203934	hsa-miR-20b	CLIP-seq
MIRT2203935	hsa-miR-3117-3p	CLIP-seq
MIRT2203936	hsa-miR-3609	CLIP-seq
MIRT2203937	hsa-miR-3663-3p	CLIP-seq
MIRT2203938	hsa-miR-4311	CLIP-seq
MIRT2203939	hsa-miR-4700-3p	CLIP-seq
MIRT2203940	hsa-miR-4796-3p	CLIP-seq
MIRT2203941	hsa-miR-5095	CLIP-seq
MIRT2203942	hsa-miR-519d	CLIP-seq
MIRT2203943	hsa-miR-548ah	CLIP-seq
MIRT2203944	hsa-miR-555	CLIP-seq
MIRT2203945	hsa-miR-556-3p	CLIP-seq
MIRT2203946	hsa-miR-579	CLIP-seq
MIRT2203947	hsa-miR-582-3p	CLIP-seq
MIRT2203948	hsa-miR-583	CLIP-seq
MIRT2203949	hsa-miR-651	CLIP-seq
MIRT2203950	hsa-miR-889	CLIP-seq
MIRT2203951	hsa-miR-93	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
GATA1	Unknown	21689417
STAT3	Unknown	21689417

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000338	Process	Protein deneddylation	IDA	19141280
GO:0000338	Process	Protein deneddylation	IMP	19214193
GO:0000785	Component	Chromatin	IDA	20978819
GO:0003713	Function	Transcription coactivator activity	TAS	8837781
GO:0003743	Function	Translation initiation factor activity	TAS	9341143
GO:0005515	Function	Protein binding	IPI	12082530, 14993265, 15234121, 15480426, 15887118, 16300740, 16410250, 17050680, 18850735, 19214193, 19444310, 19615732, 20399188, 20978819, 21145461, 21499297, 21625211, 22609399, 23776465, 23840749, 24421388, 25043011, 26456823, 27029275, 28514442, 32296183, 33961781, 37207277
GO:0005634	Component	Nucleus	IDA	16300740, 17050680, 20978819, 24421388
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16300740, 17050680, 24421388
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA	20978819
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	TAS	9341143
GO:0006412	Process	Translation	TAS	9341143
GO:0006413	Process	Translational initiation	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008021	Component	Synaptic vesicle	IDA	21102408
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008180	Component	COP9 signalosome	IBA
GO:0008180	Component	COP9 signalosome	IDA	18850735, 19214193
GO:0008180	Component	COP9 signalosome	IEA
GO:0008180	Component	COP9 signalosome	IPI	25043011
GO:0008180	Component	COP9 signalosome	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IBA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IMP	19214193
GO:0016787	Function	Hydrolase activity	IEA
GO:0019784	Function	DeNEDDylase activity	IBA
GO:0019784	Function	DeNEDDylase activity	TAS
GO:0019899	Function	Enzyme binding	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20978819
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045116	Process	Protein neddylation	NAS	24421388
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16410250
GO:0046328	Process	Regulation of JNK cascade	IDA	16410250
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16300740
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	20978819
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IDA	19246649
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA
GO:1903894	Process	Regulation of IRE1-mediated unfolded protein response	IMP	15234121
GO:1990182	Process	Exosomal secretion	IDA	19246649
GO:2000434	Process	Regulation of protein neddylation	NAS	24421388

MIM	HGNC	e!Ensembl
604850	2240	ENSG00000121022

Q92905

Protein name

COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1)

Protein function

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylat

PDB

4D10 , 4D18 , 4F7O , 4WSN , 5JOG , 5JOH , 5M5Q , 6R6H , 6R7F , 6R7H , 6R7I , 8H38 , 8H3A , 8H3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	50 → 164	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
PF18323	CSN5_C	251 → 329	Cop9 signalosome subunit 5 C-terminal domain	Domain

Sequence

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Sequence length

334

Interactions

View interactions

	Reactome
			DNA Damage Recognition in GG-NER Formation of TC-NER Pre-Incision Complex Cargo recognition for clathrin-mediated endocytosis Neddylation

COPS5 (COP9 signalosome subunit 5)