Gene Gene information from NCBI Gene database.
Entrez ID 10951
Gene name Chromobox 1
Gene symbol CBX1
Synonyms (NCBI Gene)
CBXHP1-BETAHP1Hs-betaHP1HsbetaHp1betaM31MOD1p25beta
Chromosome 17
Chromosome location 17q21.32
Summary This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can b
miRNA miRNA information provided by mirtarbase database.
522
miRTarBase ID miRNA Experiments Reference
MIRT003170 hsa-miR-210-3p immunoprecipitaionMicroarrayqRT-PCR 19826008
MIRT003170 hsa-miR-210-3p immunoprecipitaionMicroarrayqRT-PCR 19826008
MIRT016166 hsa-miR-590-3p Sequencing 20371350
MIRT016475 hsa-miR-193b-3p Microarray 20304954
MIRT021150 hsa-miR-186-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IDA 8287692
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 24270157
GO:0000785 Component Chromatin IDA 11101528
GO:0000785 Component Chromatin IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604511 1551 ENSG00000108468
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P83916
Protein name Chromobox protein homolog 1 (HP1Hsbeta) (Heterochromatin protein 1 homolog beta) (HP1 beta) (Heterochromatin protein p25) (M31) (Modifier 1 protein) (p25beta)
Protein function Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear
PDB 2FMM , 3F2U , 3Q6S , 5T1G , 6D07 , 6D08
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 21 70 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF01393 Chromo_shadow 118 170 Chromo shadow domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all adult and embryonic tissues.
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQS
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPE
RIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW
HSYPSEDDDK
KDDKN
Sequence length 185
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    HCMV Early Events