UTS2 (urotensin 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10911
Gene name Gene Name - the full gene name approved by the HGNC.
Urotensin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UTS2
Synonyms (NCBI Gene) Gene synonyms aliases
PRO1068, U-II, UCN2, UII
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT018692 hsa-miR-335-5p Microarray 18185580
MIRT019441 hsa-miR-148b-3p Microarray 17612493
MIRT1481381 hsa-miR-1208 CLIP-seq
MIRT1481382 hsa-miR-1305 CLIP-seq
MIRT1481383 hsa-miR-3671 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 10499587
GO:0005179 Function Hormone activity IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0006936 Process Muscle contraction TAS 10499587
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604097 12636 ENSG00000049247
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95399
Protein name Urotensin-2 (Urotensin II) (U-II) (UII)
Protein function Highly potent vasoconstrictor.
PDB 6HVB , 6HVC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02083 Urotensin_II 113 → 124 Urotensin II Family
Tissue specificity TISSUE SPECIFICITY: Brain specific.
Sequence 
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEML
GAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFW
KYCV
Sequence length 124
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Peptide ligand-binding receptors
G alpha (q) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hypertension Hypertensive disease rs13306026 16160878
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Rheumatoid arthritis Rheumatoid arthritis GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Show/Hide Text Mining Associations (42)
Associations from Text Mining
Disease Name Relationship Type References
Aneurysm Associate 28753597
Breast Neoplasms Associate 25112588, 25604143
Breast Neoplasms Inhibit 25604143
Carcinoma Hepatocellular Associate 25514221
Cardiovascular Diseases Associate 18284603, 28753597
Colorectal Neoplasms Associate 32375704, 32564470, 36890467
Coronary Aneurysm Associate 28753597
Coronary Artery Disease Associate 22738689
COVID 19 Associate 36333264
Dementia Vascular Associate 19638714