SLC22A7 (solute carrier family 22 member 7)

Gene

• Entrez ID: 10864
• Gene name: Solute carrier family 22 member 7
• Gene symbol: SLC22A7
• Synonyms (NCBI Gene): NLT, OAT2, hOAT11
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1354593	hsa-miR-3157-5p	CLIP-seq
MIRT1354594	hsa-miR-4452	CLIP-seq
MIRT1354595	hsa-miR-4474-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15846844
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	18216183, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9650585
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11327718, 11907186, 25904762, 26377792, 28945155
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	21446918
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	11327718
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	ISS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS	9650585
GO:0015711	Process	Organic anion transport	IEA
GO:0015711	Process	Organic anion transport	TAS	9650585
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015732	Process	Prostaglandin transport	IEA
GO:0015742	Process	Alpha-ketoglutarate transport	IDA	11327718
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9650585
GO:0016323	Component	Basolateral plasma membrane	IDA	25904762, 27053689
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	25904762
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	18216183, 25904762, 26377792, 28945155
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA

Other IDs

• MIM: 604995
• HGNC: 10971
• e!Ensembl: ENSG00000137204

Protein

• UniProt ID: Q9Y694
• Protein name: Solute carrier family 22 member 7 (Novel liver transporter) (NLT) (Organic anion transporter 2) (hOAT2)
• Protein function: [Isoform 2]: Functions as a Na(+)-independent bidirectional multispecific transporter (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:28945155). Contributes to the renal and hepatic elimination of endogenous organic compounds from the
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	75 → 481	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in liver and kidney (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:25904762). In kidney, expressed in proximal tubular cells (PubMed:25904762). Also expressed in pancreas, small intestine, spinal cord, lung
• Sequence:

  MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSH
  QDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYD
  HSEFSSTIATESQWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYV
  STLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFW
  TGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLH
  CARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFS
  YYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR
  LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLA
  PLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
  MPMKQVQN

• Sequence length: 548

Pathways

KEGG:

Bile secretion

Reactome:

Organic anion transport