Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10864
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A7
Synonyms (NCBI Gene) Gene synonyms aliases	NLT, OAT2, hOAT11
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membr

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments
MIRT1354593	hsa-miR-3157-5p	CLIP-seq
MIRT1354594	hsa-miR-4452	CLIP-seq
MIRT1354595	hsa-miR-4474-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15846844
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	18216183, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9650585
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11327718, 11907186, 25904762, 26377792, 28945155
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	21446918
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	11327718
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	ISS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS	9650585
GO:0015711	Process	Organic anion transport	IEA
GO:0015711	Process	Organic anion transport	TAS	9650585
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015732	Process	Prostaglandin transport	IEA
GO:0015742	Process	Alpha-ketoglutarate transport	IDA	11327718
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9650585
GO:0016323	Component	Basolateral plasma membrane	IDA	25904762, 27053689
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	25904762
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	18216183, 25904762, 26377792, 28945155
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
604995	10971	ENSG00000137204

Protein

UniProt ID

Q9Y694

Protein name

Solute carrier family 22 member 7 (Novel liver transporter) (NLT) (Organic anion transporter 2) (hOAT2)

Protein function

[Isoform 2]: Functions as a Na(+)-independent bidirectional multispecific transporter (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:28945155). Contributes to the renal and hepatic elimination of endogenous organic compounds from the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	75 → 481	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in liver and kidney (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:25904762). In kidney, expressed in proximal tubular cells (PubMed:25904762). Also expressed in pancreas, small intestine, spinal cord, lung

Sequence

MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSH
QDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYD
HSEFSSTIATESQWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYV
STLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFW
TGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLH
CARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFS
YYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLA
PLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
MPMKQVQN

Sequence length

548

Interactions

View interactions

	KEGG		Reactome
	Bile secretion		Organic anion transport

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes, Serum magnesium levels in type 2 diabetes	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Ischemic Stroke	Ischemic stroke	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Renal Cell	Inhibit	32461965
Carcinoma Renal Cell	Associate	37657024
Colorectal Neoplasms	Associate	34599518
Neoplasms	Associate	34132895
Neoplasms	Inhibit	35510337

SLC22A7 (solute carrier family 22 member 7)