Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10863
Gene name Gene Name - the full gene name approved by the HGNC.	ADAM metallopeptidase domain 28
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADAM28
Synonyms (NCBI Gene) Gene synonyms aliases	ADAM 28, MDC-L, MDCL, eMDC II, eMDCII
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MDCL
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531705	hsa-miR-3914	PAR-CLIP	22012620
MIRT531704	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT531703	hsa-miR-3913-3p	PAR-CLIP	22012620
MIRT531702	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT531701	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT531700	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT531699	hsa-miR-23c	PAR-CLIP	22012620
MIRT531698	hsa-miR-489-3p	PAR-CLIP	22012620
MIRT531697	hsa-miR-6511b-5p	PAR-CLIP	22012620
MIRT531696	hsa-miR-6811-5p	PAR-CLIP	22012620
MIRT531695	hsa-miR-651-5p	PAR-CLIP	22012620
MIRT531705	hsa-miR-3914	PAR-CLIP	22012620
MIRT531704	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT531703	hsa-miR-3913-3p	PAR-CLIP	22012620
MIRT531702	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT531701	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT531700	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT531699	hsa-miR-23c	PAR-CLIP	22012620
MIRT531698	hsa-miR-489-3p	PAR-CLIP	22012620
MIRT531697	hsa-miR-6511b-5p	PAR-CLIP	22012620
MIRT531696	hsa-miR-6811-5p	PAR-CLIP	22012620
MIRT531695	hsa-miR-651-5p	PAR-CLIP	22012620
MIRT766144	hsa-miR-329	CLIP-seq
MIRT766145	hsa-miR-362-3p	CLIP-seq
MIRT766146	hsa-miR-4762-5p	CLIP-seq
MIRT766147	hsa-miR-548aa	CLIP-seq
MIRT1925769	hsa-miR-3942-3p	CLIP-seq
MIRT1925770	hsa-miR-4452	CLIP-seq
MIRT1925771	hsa-miR-4775	CLIP-seq
MIRT766144	hsa-miR-329	CLIP-seq
MIRT766145	hsa-miR-362-3p	CLIP-seq
MIRT766144	hsa-miR-329	CLIP-seq
MIRT766145	hsa-miR-362-3p	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0007283	Process	Spermatogenesis	TAS	10587367
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	IDA	12777399
GO:0016021	Component	Integral component of membrane	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606188	206	ENSG00000042980

Protein

UniProt ID

Q9UKQ2

Protein name

Disintegrin and metalloproteinase domain-containing protein 28 (ADAM 28) (EC 3.4.24.-) (Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II) (eMDC II) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L) (M

Protein function

May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	29 → 156	Reprolysin family propeptide	Family
PF01421	Reprolysin	204 → 399	Reprolysin (M12B) family zinc metalloprotease	Domain
PF00200	Disintegrin	416 → 488	Disintegrin	Domain
PF08516	ADAM_CR	493 → 591	ADAM cysteine-rich	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in secondary lymphoid tissues, such as lymph node, spleen, small intestine, stomach, colon, appendix and trachea. The lymphocyte population is responsible for expression of this protein in these tissues. Isoform

Sequence

MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYK
MTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDAS
ISTCRGLRGYFSQGDQRYFIEPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDL
QQNIALPATKLVKLKDRKVQEHEKYIEYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNM
LYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATE
LAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTI
CVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNG
KSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSK
YGYCRRVDDTLIPCKANDTMCGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMV
ANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSS
VVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQRPLSTTGTRPHKQKRKPQMVK
AVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKDSNPKA

Sequence length

775

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	20544843
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29662167

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	22514692
Colorectal Neoplasms	Associate	23527725, 30840270
Diabetes Mellitus Type 2	Associate	23010875
Inflammation	Associate	23010875
Leukemia Lymphocytic Chronic B Cell	Associate	27111430
Lymphoma	Associate	34166375
Metabolic Syndrome	Associate	23010875
Multiple Myeloma	Associate	40665393
Neoplasms	Associate	23527725, 27462861, 27749584, 31602160
Neoplasms	Stimulate	29776401
Obesity	Associate	23010875, 23527725
Overweight	Associate	23527725
Pancreatic Neoplasms	Associate	31602160
Periodontitis	Associate	36927684
Prostatic Neoplasms	Associate	27749584
Prostatitis	Associate	27749584

ADAM28 (ADAM metallopeptidase domain 28)