CCL27 (C-C motif chemokine ligand 27)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10850
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL27
Synonyms (NCBI Gene) Gene synonyms aliases
ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT029509 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28381538
GO:0005576 Component Extracellular region IBA 21873635
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IEA
GO:0006935 Process Chemotaxis TAS 10588729
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604833 10626 ENSG00000213927
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y4X3
Protein name C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)
Protein function Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
PDB 2KUM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 → 92 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Testis, thymus, placenta, ovary and skin.
Sequence 
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Sequence length 112
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Contact Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25724174
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 19503088
Show/Hide Text Mining Associations (43)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 28648867
Breast Neoplasms Associate 35725915
Colitis Ulcerative Inhibit 33295628
Coronary Artery Disease Associate 11527622
COVID 19 Associate 34188167, 35343786
Crohn Disease Inhibit 33295628
Dermatitis Atopic Associate 16955181, 31855303
Dermatitis Atopic Stimulate 27077833
Diabetes Mellitus Stimulate 33371882
Epidermolysis Bullosa Associate 28094098