Gene Gene information from NCBI Gene database.
Entrez ID 10818
Gene name Fibroblast growth factor receptor substrate 2
Gene symbol FRS2
Synonyms (NCBI Gene)
FRS1AFRS2AFRS2alphaSNTSNT-1SNT1
Chromosome 12
Chromosome location 12q15
miRNA miRNA information provided by mirtarbase database.
1075
miRTarBase ID miRNA Experiments Reference
MIRT016233 hsa-miR-548b-3p Sequencing 20371350
MIRT021159 hsa-miR-186-5p Sequencing 20371350
MIRT025864 hsa-miR-7-5p Sequencing 20371350
MIRT027362 hsa-miR-101-3p Sequencing 20371350
MIRT027936 hsa-miR-96-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0001702 Process Gastrulation with mouth forming second IEA
GO:0001759 Process Organ induction IEA
GO:0002088 Process Lens development in camera-type eye IEA
GO:0003281 Process Ventricular septum development IEA
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607743 16971 ENSG00000166225
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WU20
Protein name Fibroblast growth factor receptor substrate 2 (FGFR substrate 2) (FGFR-signaling adaptor SNT) (Suc1-associated neurotrophic factor target 1) (SNT-1)
Protein function Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase,
PDB 1XR0 , 2MFQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02174 IRS 17 109 PTB domain (IRS-1 type) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. {ECO:0000269|PubMed:10092678}.
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNS
INVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Sequence length 508
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Thermogenesis
Neurotrophin signaling pathway
Proteoglycans in cancer
  PI3K Cascade
PIP3 activates AKT signaling
Frs2-mediated activation
Constitutive Signaling by Aberrant PI3K in Cancer
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
FRS-mediated FGFR2 signaling
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 fusions in cancer
Signaling by FGFR3 point mutants in cancer
RET signaling
Activated NTRK2 signals through FRS2 and FRS3