Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10818
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor receptor substrate 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FRS2
Synonyms (NCBI Gene) Gene synonyms aliases
FRS1A, FRS2A, FRS2alpha, SNT, SNT-1, SNT1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q15
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016233 hsa-miR-548b-3p Sequencing 20371350
MIRT021159 hsa-miR-186-5p Sequencing 20371350
MIRT025864 hsa-miR-7-5p Sequencing 20371350
MIRT027362 hsa-miR-101-3p Sequencing 20371350
MIRT027936 hsa-miR-96-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0000186 Process Activation of MAPKK activity TAS
GO:0000187 Process Activation of MAPK activity IEA
GO:0001702 Process Gastrulation with mouth forming second IEA
GO:0001759 Process Organ induction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607743 16971 ENSG00000166225
Protein
UniProt ID Q8WU20
Protein name Fibroblast growth factor receptor substrate 2 (FGFR substrate 2) (FGFR-signaling adaptor SNT) (Suc1-associated neurotrophic factor target 1) (SNT-1)
Protein function Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase,
PDB 1XR0 , 2MFQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02174 IRS 17 109 PTB domain (IRS-1 type) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. {ECO:0000269|PubMed:10092678}.
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNS
INVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Sequence length 508
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Thermogenesis
Neurotrophin signaling pathway
Proteoglycans in cancer
  PI3K Cascade
PIP3 activates AKT signaling
Frs2-mediated activation
Constitutive Signaling by Aberrant PI3K in Cancer
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
FRS-mediated FGFR2 signaling
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 fusions in cancer
Signaling by FGFR3 point mutants in cancer
RET signaling
Activated NTRK2 signals through FRS2 and FRS3
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32515146
Adrenocortical Carcinoma Associate 34410225
Arthritis Rheumatoid Associate 39342401
Atherosclerosis Associate 32141564
Breast Neoplasms Associate 27533459
Calcinosis Cutis Associate 25900027
Carcinoma Hepatocellular Associate 37458641
Carcinoma Pancreatic Ductal Associate 28558797
Carcinoma Renal Cell Associate 25900027
Colorectal Neoplasms Associate 36849394