Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10806
Gene name Gene Name - the full gene name approved by the HGNC.	SHH signaling and ciliogenesis regulator SDCCAG8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SDCCAG8
Synonyms (NCBI Gene) Gene synonyms aliases	BBS16, CCCAP, CCCAP SLSN7, HSPC085, NPHP10, NY-CO-8, SLSN7, hCCCAP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BBS16, SLSN7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q43-q44
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy. [provided by RefSeq, Oct 2010]

Show/Hide all(21)

SNP ID	Visualize variation	Clinical significance	Consequence
rs143407309	C>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, intron variant, genic upstream transcript variant, 5 prime UTR variant, non coding transcript variant
rs148818431	T>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	5 prime UTR variant, non coding transcript variant, synonymous variant, coding sequence variant, genic upstream transcript variant
rs149359674	G>A,T	Conflicting-interpretations-of-pathogenicity	Missense variant, non coding transcript variant, coding sequence variant, intron variant, genic upstream transcript variant
rs150070966	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, non coding transcript variant, coding sequence variant, intron variant, genic upstream transcript variant
rs267607031	A>T	Pathogenic	Genic upstream transcript variant, non coding transcript variant, intron variant, coding sequence variant, 5 prime UTR variant, stop gained
rs387906218	->G	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant, genic downstream transcript variant
rs397515336	GTGT>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant, genic downstream transcript variant
rs397515337	C>T	Pathogenic	5 prime UTR variant, intron variant, genic upstream transcript variant
rs587777846	ATAG>-	Pathogenic	Frameshift variant, non coding transcript variant, intron variant, genic downstream transcript variant, coding sequence variant
rs756907665	G>A	Likely-pathogenic	Genic upstream transcript variant, splice donor variant
rs770084716	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant, stop gained
rs778900414	G>-	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant, non coding transcript variant
rs797045946	A>G	Pathogenic	Splice acceptor variant, genic upstream transcript variant
rs797045947	C>T	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained, 5 prime UTR variant, non coding transcript variant
rs797045948	G>A	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained, intron variant, 5 prime UTR variant, non coding transcript variant
rs1286714661	C>T	Likely-pathogenic	Stop gained, genic downstream transcript variant, non coding transcript variant, coding sequence variant, intron variant
rs1390963789	A>-	Likely-pathogenic	Genic downstream transcript variant, frameshift variant, non coding transcript variant, coding sequence variant
rs1460888769	G>A	Likely-pathogenic	Genic upstream transcript variant, splice acceptor variant
rs1558264626	T>-	Pathogenic	Intron variant, 5 prime UTR variant, stop gained, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs1573920009	C>T	Pathogenic	Intron variant, genic downstream transcript variant, coding sequence variant, non coding transcript variant, stop gained
rs1573930690	G>A	Likely-pathogenic	Splice donor variant, intron variant, genic downstream transcript variant

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017025	hsa-miR-335-5p	Microarray	18185580
MIRT022273	hsa-miR-124-3p	Microarray	18668037
MIRT1331653	hsa-miR-1205	CLIP-seq
MIRT1331654	hsa-miR-1224-5p	CLIP-seq
MIRT1331655	hsa-miR-3929	CLIP-seq
MIRT1331656	hsa-miR-4286	CLIP-seq
MIRT1331657	hsa-miR-4323	CLIP-seq
MIRT1331658	hsa-miR-4418	CLIP-seq
MIRT1331659	hsa-miR-4419b	CLIP-seq
MIRT1331660	hsa-miR-4478	CLIP-seq
MIRT1331661	hsa-miR-4751	CLIP-seq
MIRT1331662	hsa-miR-4758-3p	CLIP-seq
MIRT1331663	hsa-miR-509-3-5p	CLIP-seq
MIRT1331664	hsa-miR-509-5p	CLIP-seq
MIRT2322694	hsa-miR-3688-5p	CLIP-seq
MIRT2322695	hsa-miR-4440	CLIP-seq
MIRT2322696	hsa-miR-4466	CLIP-seq
MIRT2322697	hsa-miR-4474-3p	CLIP-seq
MIRT2322698	hsa-miR-493	CLIP-seq
MIRT2322699	hsa-miR-675	CLIP-seq
MIRT1331653	hsa-miR-1205	CLIP-seq
MIRT2618765	hsa-miR-28-5p	CLIP-seq
MIRT2618766	hsa-miR-3139	CLIP-seq
MIRT2618767	hsa-miR-3194-3p	CLIP-seq
MIRT2618768	hsa-miR-3197	CLIP-seq
MIRT1331655	hsa-miR-3929	CLIP-seq
MIRT1331656	hsa-miR-4286	CLIP-seq
MIRT1331657	hsa-miR-4323	CLIP-seq
MIRT1331658	hsa-miR-4418	CLIP-seq
MIRT1331659	hsa-miR-4419b	CLIP-seq
MIRT1331660	hsa-miR-4478	CLIP-seq
MIRT2618769	hsa-miR-4649-3p	CLIP-seq
MIRT2618770	hsa-miR-4733-3p	CLIP-seq
MIRT1331662	hsa-miR-4758-3p	CLIP-seq
MIRT1331663	hsa-miR-509-3-5p	CLIP-seq
MIRT1331664	hsa-miR-509-5p	CLIP-seq
MIRT2618771	hsa-miR-665	CLIP-seq
MIRT2618772	hsa-miR-708	CLIP-seq
MIRT2618773	hsa-miR-767-3p	CLIP-seq
MIRT2618765	hsa-miR-28-5p	CLIP-seq
MIRT2618766	hsa-miR-3139	CLIP-seq
MIRT2618767	hsa-miR-3194-3p	CLIP-seq
MIRT2618770	hsa-miR-4733-3p	CLIP-seq
MIRT2618771	hsa-miR-665	CLIP-seq
MIRT2618772	hsa-miR-708	CLIP-seq
MIRT2618773	hsa-miR-767-3p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0001764	Process	Neuron migration	IBA	21873635
GO:0005515	Function	Protein binding	IPI	20835237, 22190034, 22940612, 27224062
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005814	Component	Centriole	IBA	21873635
GO:0005814	Component	Centriole	IDA	20835237
GO:0005829	Component	Cytosol	TAS
GO:0005911	Component	Cell-cell junction	IDA	20835237
GO:0007098	Process	Centrosome cycle	IEA
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0030010	Process	Establishment of cell polarity	IBA	21873635
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0031023	Process	Microtubule organizing center organization	IBA	21873635
GO:0034451	Component	Centriolar satellite	IEA
GO:0035148	Process	Tube formation	IBA	21873635
GO:0035148	Process	Tube formation	ISS
GO:0036064	Component	Ciliary basal body	IEA
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:0097733	Component	Photoreceptor cell cilium	IEA
GO:1902017	Process	Regulation of cilium assembly	IMP	27224062

MIM	HGNC	e!Ensembl
613524	10671	ENSG00000054282

Protein

UniProt ID

Q86SQ7

Protein name

Serologically defined colon cancer antigen 8 (Antigen NY-CO-8) (Centrosomal colon cancer autoantigen protein) (hCCCAP)

Protein function

Plays a role in the establishment of cell polarity and epithelial lumen formation (By similarity). Also plays an essential role in ciliogenesis and subsequent Hedgehog signaling pathway that requires the presence of intact primary cilia for path

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15964	CCCAP	6 → 706	Centrosomal colon cancer autoantigen protein family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, prostate, testis, ovary, small intestine, colon, mucosa, colon and renal cancer tumors. {ECO:0000269|PubMed:9610721}.

Sequence

MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNED
ARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVH
TINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLD
ASGNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEE
SQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNV
HMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQ
CDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEA
QVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRA
KTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQ
EKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLK
EECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMK
QRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC

Sequence length

713

Interactions

View interactions

	Reactome
			Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane AURKA Activation by TPX2

Show/Hide Causal Diseases (19)

Disease term	Disease name	dbSNP ID	References
Causal
Bardet-biedl syndrome	Bardet-Biedl Syndrome, BARDET-BIEDL SYNDROME 16, Bardet-Biedl syndrome	rs397704728, rs397515335, rs397515337, rs267607031, rs121918327, rs587777801, rs587777802, rs121918328, rs587777803, rs549625604, rs137852837, rs137852833, rs137852835, rs267606719, rs199874059 View all (560 more)	20835237, 22190896, 25529582
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Hypertension	Hypertensive disease	rs13306026
Kidney disease	Chronic kidney disease stage 5, Chronic Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	25529582
Nephronophthisis	Nephronophthisis	rs62635288, rs267607116, rs201893408, rs267607117, rs202149403, rs118204032, rs121918244, rs750962965, rs1474058708, rs119456959, rs119456960, rs119456961, rs119456962, rs267606916, rs137852856 View all (190 more)
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910 View all (152 more)
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20421936
Renal cyst	Simple renal cyst	rs376586707, rs431905522, rs1057518761, rs1555454411, rs140039128, rs1567413573
Renal dysplasia and retinal aplasia	Renal dysplasia and retinal aplasia (disorder)	rs121918244, rs387906980, rs753627675, rs866982675, rs1573920009, rs1576559094	22819833, 22190896
Renal insufficiency	Renal Insufficiency	rs1596536873
Retinal dystrophy	Retinal Dystrophies	rs267606794, rs200691042, rs397704718, rs202193201, rs794728002, rs121965036, rs121965057, rs121918129, rs137853190, rs386834252, rs121918165, rs137853113, rs137853114, rs121918328, rs587777803 View all (2328 more)
Retinitis pigmentosa	Retinitis Pigmentosa	rs267606794, rs200691042, rs397704718, rs202193201, rs267606793, rs2147483647, rs779886453, rs267606691, rs794728002, rs878853253, rs137853189, rs137853190, rs137853112, rs137853113, rs137853114 View all (1830 more)
Rod-cone dystrophy	Rod-Cone Dystrophy	rs267606641, rs199476133, rs193302849, rs777668842, rs775518991, rs752300607, rs142759730, rs756225251, rs536742386, rs1588830568, rs778907433
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	26198764, 30285260, 23974872, 21926974, 24166486, 25056061, 22614287, 31268507, 28991256, 31374203
Senior-loken syndrome	SENIOR-LOKEN SYNDROME 7, Senior-Loken syndrome	rs397515335, rs387906218, rs397515336, rs397515337, rs2137713030, rs121918244, rs750962965, rs1156803164, rs1474058708, rs121918245, rs137852922, rs137852923, rs387906980, rs786200929, rs373909351 View all (35 more)	20835237, 25529582, 22190896

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Otitis media	Recurrent otitis media	ClinVar
Renal dysplasia	Renal Cell Dysplasia, Renal dysplasia	ClinVar
Senior-Loken Syndrome	Senior-Loken syndrome	GenCC
Bardet-Biedl Syndrome	Bardet-Biedl syndrome	GenCC
Kidney Disease	Kidney Disease	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Albuminuria	Associate	24157943
Bardet Biedl Syndrome	Associate	21052717, 22773737, 31534065, 35112343
Bipolar Disorder	Associate	27759212
Callosities	Associate	21934713
Ciliopathies	Associate	29455858
Cone Rod Dystrophies	Associate	31534065
Kidney Diseases	Associate	24157943, 34632641
Kidney Failure Chronic	Associate	24157943, 31534065, 40725491
Leber Congenital Amaurosis	Associate	40725491
Melanoma Cutaneous Malignant	Associate	34375487
Nephronophthisis familial juvenile	Associate	31534065, 34632641
Obesity	Associate	22095114, 31534065
Ocular Motility Disorders	Associate	31534065
Opioid Related Disorders	Associate	32099098
Overweight	Associate	22095114
Polydactyly	Associate	31534065
Renal Insufficiency	Associate	35112343
Schizophrenia	Associate	22614287, 32099098
Senior Loken Syndrome	Associate	40725491
Weight Loss	Inhibit	22095114

SDCCAG8 (SHH signaling and ciliogenesis regulator SDCCAG8)