Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10803
Gene name	C-C motif chemokine receptor 9
Gene symbol	CCR9
Synonyms (NCBI Gene)	CC-CKR-9CDw199GPR-9-6GPR28
Chromosome	3
Chromosome location	3p21.31
Summary	The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the beta chemokine receptor family. Chemokines and their receptors are key regulators of thymocyte migration and maturation in normal and inf

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018889	hsa-miR-335-5p	Microarray	18185580
MIRT020973	hsa-miR-155-5p	Proteomics	19193853
MIRT021275	hsa-miR-146a-5p	Microarray	18057241
MIRT873296	hsa-miR-1252	CLIP-seq
MIRT873297	hsa-miR-154	CLIP-seq
MIRT873298	hsa-miR-155	CLIP-seq
MIRT873299	hsa-miR-25	CLIP-seq
MIRT873300	hsa-miR-302f	CLIP-seq
MIRT873301	hsa-miR-31	CLIP-seq
MIRT873302	hsa-miR-3128	CLIP-seq
MIRT873303	hsa-miR-32	CLIP-seq
MIRT873304	hsa-miR-362-5p	CLIP-seq
MIRT873305	hsa-miR-363	CLIP-seq
MIRT873306	hsa-miR-367	CLIP-seq
MIRT873307	hsa-miR-3977	CLIP-seq
MIRT873308	hsa-miR-4420	CLIP-seq
MIRT873309	hsa-miR-4428	CLIP-seq
MIRT873310	hsa-miR-4685-5p	CLIP-seq
MIRT873311	hsa-miR-4696	CLIP-seq
MIRT873312	hsa-miR-4773	CLIP-seq
MIRT873313	hsa-miR-500a	CLIP-seq
MIRT873314	hsa-miR-500b	CLIP-seq
MIRT873315	hsa-miR-548aa	CLIP-seq
MIRT873316	hsa-miR-603	CLIP-seq
MIRT873317	hsa-miR-92a	CLIP-seq
MIRT873318	hsa-miR-92b	CLIP-seq
MIRT1959113	hsa-miR-1227	CLIP-seq
MIRT1959114	hsa-miR-421	CLIP-seq
MIRT1959115	hsa-miR-4252	CLIP-seq
MIRT1959116	hsa-miR-4709-5p	CLIP-seq
MIRT2196044	hsa-miR-15a	CLIP-seq
MIRT2196045	hsa-miR-15b	CLIP-seq
MIRT2196046	hsa-miR-16	CLIP-seq
MIRT2196047	hsa-miR-195	CLIP-seq
MIRT2196048	hsa-miR-3137	CLIP-seq
MIRT2196049	hsa-miR-424	CLIP-seq
MIRT2196050	hsa-miR-4524	CLIP-seq
MIRT2196051	hsa-miR-4676-5p	CLIP-seq
MIRT2196052	hsa-miR-497	CLIP-seq
MIRT2196053	hsa-miR-503	CLIP-seq
MIRT2196054	hsa-miR-575	CLIP-seq
MIRT2196055	hsa-miR-646	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002305	Process	CD8-positive, gamma-delta intraepithelial T cell differentiation	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10229797
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10229797
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10640743
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10229797
GO:0006968	Process	Cellular defense response	TAS	10544196
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10544196
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10229797
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	18308860
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
604738	1610	ENSG00000173585

P51686

Protein name

C-C chemokine receptor type 9 (C-C CKR-9) (CC-CKR-9) (CCR-9) (G-protein coupled receptor 28) (GPR-9-6) (CD antigen CDw199)

Protein function

Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level. ; (Microbial infection) Alternative coreceptor with CD4

PDB

5LWE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	65 → 317	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the thymus and low in lymph nodes and spleen. {ECO:0000269|PubMed:10229797, ECO:0000269|PubMed:10640743}.

Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL

Sequence length

369

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Intestinal immune network for IgA production		Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Bardet-Biedl syndrome 17	Conflicting classifications of pathogenicity	rs1438760537	RCV003336048

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	21637913, 25296976
Adenocarcinoma Mucinous	Associate	20649989, 21637913
Adenocarcinoma of Lung	Stimulate	26168791
Adenocarcinoma of Lung	Associate	32308544
Arthritis Rheumatoid	Associate	20738854
Asthma	Associate	16210593
Breast Neoplasms	Associate	21344163
Carcinogenesis	Associate	26168791
Carcinoma Non Small Cell Lung	Stimulate	25296976
Carcinoma Non Small Cell Lung	Associate	26168791
Carcinoma Pancreatic Ductal	Associate	31432181
Carcinoma Papillary	Associate	20649989
Celiac Disease	Associate	27015091
Cholangiocarcinoma	Associate	33045415
Cholangitis Sclerosing	Associate	15557349, 34633679
Colitis	Associate	26873648
Colitis Ulcerative	Stimulate	23039882
Colorectal Neoplasms	Associate	29020986
Conjunctivitis Allergic	Associate	24368924
COVID 19	Associate	34799557, 35212764, 37085563
Crohn Disease	Stimulate	23039882
Crohn Disease	Associate	28961803
Cystadenoma Papillary	Associate	21637913
DiGeorge Syndrome	Associate	20491792
Drug Hypersensitivity	Associate	16210593
Dysgerminoma	Associate	21637913
Endometriosis	Associate	20081876
Enterocolitis Necrotizing	Stimulate	31801814
Farber Lipogranulomatosis	Associate	25296976
Fibroma	Associate	21637913
Glomerulonephritis IGA	Associate	35115327
HIV Infections	Associate	22156200, 27203285, 34500304
Infections	Stimulate	12970431
Inflammation	Associate	30770703, 37569326
Inflammatory Bowel Diseases	Associate	23039882
Inflammatory Bowel Diseases	Stimulate	34633679
Leukemia	Associate	14656893, 19567201
Liver Diseases	Associate	34633679
Lung Neoplasms	Associate	19309748, 32308544
Lymphatic Metastasis	Stimulate	26168791
Lymphoma B Cell Marginal Zone	Associate	22936065
Lymphoma Follicular	Stimulate	35887224
Lymphoma Large B Cell Diffuse	Stimulate	22936065
Lymphoma Large B Cell Diffuse	Associate	35887224
Lymphoma T Cell Cutaneous	Associate	28370539
Machado Joseph Disease	Associate	25914309
Melanoma	Associate	15086554, 18245522, 22433180
Melanoma Cutaneous Malignant	Associate	18245522, 31983065
Mucositis	Associate	22156200
Multiple Sclerosis Chronic Progressive	Inhibit	30770703
Neoplasm Metastasis	Associate	15086554, 18245522, 19567201, 25296976, 26168791
Neoplasm Metastasis	Stimulate	32308544
Neoplasms	Associate	20649989, 25986937, 26003048, 26168791, 32308544
Neuromyelitis Optica	Associate	30770703
Ovarian Neoplasms	Associate	20649989, 21637913
Pancreatic Neoplasms	Associate	26003048
Polyps	Associate	37085563
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	14656893, 19567201
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19567201, 23326330, 34808497
Prostatic Neoplasms	Associate	28903065
Sjogren's Syndrome	Stimulate	31733111
Sjogren's Syndrome	Associate	31733111, 34386009, 35720379, 36505431, 37569326
Spondylitis Ankylosing	Associate	26841353
Status Asthmaticus	Associate	16210593

CCR9 (C-C motif chemokine receptor 9)